Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCR5 Rabbit pAb (APR25694N)

Product Specifications

Background

This gene encodes a multi-pass membrane protein that belongs to the CXC chemokine receptor family. It is expressed in mature B-cells and Burkitt's lymphoma. This cytokine receptor binds to B-lymphocyte chemoattractant (BLC), and is involved in B-cell migration into B-cell follicles of spleen and Peyer patches. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CXCR5 Rabbit pAb (APR25694N) .

Synonyms

CXCR5; BLR1; CD185; MDR15

Gene ID

643

UniProt

P32302

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 36kDa/41kDa Observed MW: 45kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=643

Uniprot URL

https://www.uniprot.org/uniprot/P32302

AA Sequence

LPVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQLFPSWRRSSLSESENATSLTTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human hsa-miR-6740-5p miRNA Agomir
abx882144-01 5 nmol

Human hsa-miR-6740-5p miRNA Agomir

Sign In for Pricing
View Details
Human hsa-miR-6740-5p miRNA Agomir
abx882144-02 10 nmol

Human hsa-miR-6740-5p miRNA Agomir

Sign In for Pricing
View Details
CXCL3 Human Pre-designed siRNA Set A
HY-RS03392 1 Set

CXCL3 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
HSP60 (HSPD1/875), CF568 conjugate, 0.1mg/mL
BNC680875-500 1x 500 µL

HSP60 (HSPD1/875), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KD 5170 25mg
A15354-25 25 mg

KD 5170 25mg

Sign In for Pricing
View Details
LRRC1 Protein Vector (Mouse) (pPB-N-His)
PV197531 500 ng

LRRC1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details