Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CISD2 Rabbit pAb (APR25681N)

Product Specifications

Background

The protein encoded by this gene is a zinc finger protein that localizes to the endoplasmic reticulum. The encoded protein binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CISD2 Rabbit pAb (APR25681N) .

Synonyms

CISD2; ERIS; Miner1; NAF-1; WFS2; ZCD2

Gene ID

493856

UniProt

Q8N5K1

Cellular Locus

Endoplasmic reticulum membrane, Mitochondrion outer membrane, Single-pass membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 15kDa Observed MW: 15kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=493856

Uniprot URL

https://www.uniprot.org/uniprot/Q8N5K1

AA Sequence

PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tpd52 (NM_001025264) Mouse Tagged Lenti ORF Clone
MR215226L4 10 µg

Tpd52 (NM_001025264) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human TLCD1 Pre-designed siRNA Set A
SI016686A 1 Each

Human TLCD1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
3,6-Dibromopicolinic acid
427556-01 100 mg

3,6-Dibromopicolinic acid

Sign In for Pricing
View Details
3,6-Dibromopicolinic acid
427556-02 250 mg

3,6-Dibromopicolinic acid

Sign In for Pricing
View Details
Mouse DNA polymerase beta (POLB) ELISA Kit
abx510948 96 Tests

Mouse DNA polymerase beta (POLB) ELISA Kit

Sign In for Pricing
View Details
MRGG CRISPR Activation Plasmid (m2)
sc-436348-ACT-2 20 µg

MRGG CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details