Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBR4 Rabbit pAb (APR25657N)

Product Specifications

Background

Component of the heterotetramer complex KAR (3-ketoacyl-[acyl carrier protein] reductase or 3-ketoacyl-[ACP] reductase that forms part of the mitochondrial fatty acid synthase (mtFAS. Beta-subunit of the KAR heterotetramer complex, responsible for the 3-ketoacyl-ACP reductase activity of the mtFAS, reduces 3-oxoacyl-[ACP] to (3R-hydroxyacyl-[ACP] in a NADPH-dependent manner with no chain length preference, thereby participating in mitochondrial fatty acid biosynthesis. The homotetramer has NADPH-dependent quinone reductase activity (in vitro, hence could play a role in protection against cytotoxicity of exogenous quinones. As a heterotetramer, it can also reduce 9,10-phenanthrenequinone, 1,4-benzoquinone and various other o-quinones and p-quinones (in vitro.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CBR4 Rabbit pAb (APR25657N) .

Synonyms

CBR4; SDR45C1

Gene ID

84869

UniProt

Q8N4T8

Cellular Locus

Mitochondrion matrix

Dilution

WB 1:200 - 1:2000 IHC 1:20 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 18kDa/25kDa Observed MW: 25kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=84869

Uniprot URL

https://www.uniprot.org/uniprot/Q8N4T8

AA Sequence

MDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana Myrosinase 4 (TGG4)
MBS1419943-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Myrosinase 4 (TGG4)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Myrosinase 4 (TGG4)
MBS1419943-02 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Myrosinase 4 (TGG4)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Myrosinase 4 (TGG4)
MBS1419943-03 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Myrosinase 4 (TGG4)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Myrosinase 4 (TGG4)
MBS1419943-04 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana Myrosinase 4 (TGG4)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Myrosinase 4 (TGG4)
MBS1419943-05 0.02 mg (Baculovirus)

Recombinant Arabidopsis thaliana Myrosinase 4 (TGG4)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Myrosinase 4 (TGG4)
MBS1419943-06 0.02 mg (Mammalian-Cell)

Recombinant Arabidopsis thaliana Myrosinase 4 (TGG4)

Sign In for Pricing
View Details