Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPK Rabbit pAb (APR25612N)

Product Specifications

Background

This gene encodes a serine/threonine protein kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. The encoded protein may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. Overexpression of this gene has been implicated in tumorigenesis. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SPK Rabbit pAb (APR25612N) .

Synonyms

PBK; CT84; HEL164; Nori-3; SPK; TOPK

Gene ID

55872

UniProt

Q96KB5

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 36kDa/37kDa Observed MW: 36kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55872

Uniprot URL

https://www.uniprot.org/uniprot/Q96KB5

AA Sequence

MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal FABP6 Antibody (201) [DyLight 488]
NBP2-90127G 0.1 mL

Rabbit Monoclonal FABP6 Antibody (201) [DyLight 488]

Sign In for Pricing
View Details
LOC100363246 3'UTR GFP Stable Cell Line
TU258640 1.0 mL

LOC100363246 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit Cytokeratin 5, clone EP1601Y Antibody
orb1087838 7 mL

Rabbit Cytokeratin 5, clone EP1601Y Antibody

Sign In for Pricing
View Details
Rat BST1 siRNA
abx909342-01 15 nmol

Rat BST1 siRNA

Sign In for Pricing
View Details
Rat BST1 siRNA
abx909342-02 30 nmol

Rat BST1 siRNA

Sign In for Pricing
View Details
CCKBR Polyclonal Antibody
MBS2566344-01 0.06 mL

CCKBR Polyclonal Antibody

Sign In for Pricing
View Details