Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDP1 Rabbit pAb (APR25611N)

Product Specifications

Background

The protein encoded by this gene is involved in repairing stalled topoisomerase I-DNA complexes by catalyzing the hydrolysis of the phosphodiester bond between the tyrosine residue of topoisomerase I and the 3-prime phosphate of DNA. This protein may also remove glycolate from single-stranded DNA containing 3-prime phosphoglycolate, suggesting a role in repair of free-radical mediated DNA double-strand breaks. This gene is a member of the phospholipase D family and contains two PLD phosphodiesterase domains. Mutations in this gene are associated with the disease spinocerebellar ataxia with axonal neuropathy (SCAN1) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TDP1 Rabbit pAb (APR25611N) .

Synonyms

TDP1

Gene ID

55775

UniProt

Q9NUW8

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 41kDa/68kDa Observed MW: 70kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55775

Uniprot URL

https://www.uniprot.org/uniprot/Q9NUW8

AA Sequence

MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TYK2 Polyclonal Antibody
TMAB-13908-01 50 μL

Anti-TYK2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-TYK2 Polyclonal Antibody
TMAB-13908-02 100 µL

Anti-TYK2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-TYK2 Polyclonal Antibody
TMAB-13908-03 200 µL

Anti-TYK2 Polyclonal Antibody

Sign In for Pricing
View Details
Secretogranin-2 (SCG2) Antibody
abx115412 100 µL

Secretogranin-2 (SCG2) Antibody

Sign In for Pricing
View Details
ALAD Human Pre-designed siRNA Set A
HY-RS00553 1 Set

ALAD Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
WDR37 siRNA (Mouse)
MBS8205579-01 15 nmol

WDR37 siRNA (Mouse)

Sign In for Pricing
View Details