Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CC2D1A Rabbit pAb (APR25600N)

Product Specifications

Background

This gene encodes a transcriptional repressor that binds to a conserved 14-bp 5'-repressor element and regulates expression of the 5-hydroxytryptamine (serotonin) receptor 1A gene in neuronal cells. The DNA binding and transcriptional repressor activities of the protein are inhibited by calcium. A mutation in this gene results in nonsyndromic mental retardation-3.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CC2D1A Rabbit pAb (APR25600N) .

Synonyms

CC2D1A; FREUD-1; Freud-1/Aki1; MRT3

Gene ID

54862

UniProt

Q6P1N0

Cellular Locus

Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center

Dilution

WB 1:1000 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 103kDa/104kDa Observed MW: 131kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=54862

Uniprot URL

https://www.uniprot.org/uniprot/Q6P1N0

AA Sequence

MHKRKGPPGPPGRGAAAARQLGLLVDLSPDGLMIPEDGANDEELEAEFLALVGGQPPALEKLKGKGPLPMEAIEKMASLCMRDPDEDEEEGTDEDDLEADDDLLAELNEVLGEEQKASETPPPVAQPKPEAPHPGLETTLQERLALYQTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phenmedipham-ethyl
TRC-P314605-250MG 250 mg

Phenmedipham-ethyl

Sign In for Pricing
View Details
STC2 Polyclonal Antibody
RD87231A-01 60 μL

STC2 Polyclonal Antibody

Sign In for Pricing
View Details
STC2 Polyclonal Antibody
RD87231A-02 120 μL

STC2 Polyclonal Antibody

Sign In for Pricing
View Details
STC2 Polyclonal Antibody
RD87231A-03 200 µL

STC2 Polyclonal Antibody

Sign In for Pricing
View Details
MED26 (Mediator of RNA Polymerase II Transcription Subunit 26, Activator-recruited Cofactor 70kD Component, ARC70, Cofactor Required for Sp1 Transcriptional Activation Subunit 7, CRSP Complex Subunit 7, Mediator Complex Subunit 26, Transcriptional Coactivator CRSP70, ARC70, CRSP7) (APC)
129543-APC 100 µL

MED26 (Mediator of RNA Polymerase II Transcription Subunit 26, Activator-recruited Cofactor 70kD Component, ARC70, Cofactor Required for Sp1 Transcriptional Activation Subunit 7, CRSP Complex Subunit 7, Mediator Complex Subunit 26, Transcriptional Coactivator CRSP70, ARC70, CRSP7) (APC)

Sign In for Pricing
View Details
Rabbit calpain 1 (CAPN1) ELISA kit
GTR10471521 96 Well

Rabbit calpain 1 (CAPN1) ELISA kit

Sign In for Pricing
View Details