What is the catalog number for SPA17 Rabbit pAb (APR25593N)?

The catalog number for SPA17 Rabbit pAb (APR25593N) is APR25593N.

What sizes are available for SPA17 Rabbit pAb (APR25593N)?

SPA17 Rabbit pAb (APR25593N) is available in the following size(s): 50 µL, 100 µL, 200 µL.

How many pack sizes does SPA17 Rabbit pAb (APR25593N) come in?

SPA17 Rabbit pAb (APR25593N) is available in 3 different pack sizes.

Is SPA17 Rabbit pAb (APR25593N) in stock?

SPA17 Rabbit pAb (APR25593N) is currently made to order / not held in immediate stock. Contact us for lead time.

SPA17 Rabbit pAb (APR25593N)

Product Specifications

Background

This gene encodes a protein present at the cell surface. The N-terminus has sequence similarity to human cAMP-dependent protein kinase A (PKA) type II alpha regulatory subunit (RIIa) while the C-terminus has an IQ calmodulin-binding motif. The central portion of the protein has carbohydrate binding motifs and likely functions in cell-cell adhesion. The protein was initially characterized by its involvement in the binding of sperm to the zona pellucida of the oocyte. Recent studies indicate that it is also involved in additional cell-cell adhesion functions such as immune cell migration and metastasis. A retrotransposed pseudogene is present on chromosome 10q22.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SPA17 Rabbit pAb (APR25593N) .

Synonyms

SPA17; CT22; SP17; SP17-1

Gene ID

53340

UniProt

Q15506

Cellular Locus

Membrane, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa Observed MW: 17kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=53340

Uniprot URL

https://www.uniprot.org/uniprot/Q15506

AA Sequence

MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEENK