Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYT17 Rabbit pAb (APR25592N)

Product Specifications

Background

Plays a role in dendrite formation by melanocytes.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SYT17 Rabbit pAb (APR25592N) .

Synonyms

SYT17; sytXVII

Gene ID

51760

UniProt

Q9BSW7

Cellular Locus

Membrane, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 53kDa Observed MW: 54kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51760

Uniprot URL

https://www.uniprot.org/uniprot/Q9BSW7

AA Sequence

KPIEFGVLSAKKEPIQPSVLRRTYNPDDYFRKFEPHLYSLDSNSDDVDSLTDEEILSKYQLGMLHFSTQYDLLHNHLTVRVIEARDLPPPISHDGSRQDMAHSNPYVKICLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVSVPLCEVDLVKGGHWWKALIPSSQNEVELGELLLSLNYLPSAGRLNVDVIRAKQLLQTDVSQGSDPFVKIQLVHGLKLVKTKKTSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSNDFIGRIVIGQYSSGPSETNHWRRMLNTHRTAVEQWHSLRSRAECDRVSPASLEVT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human LOC645188 sgRNA gene knockout kit - Lentiviral human LOC645188 sgRNA gene knockout kit (100)
GTR15362878 1 Vial

Lentiviral human LOC645188 sgRNA gene knockout kit - Lentiviral human LOC645188 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
RGD1565796 Protein Vector (Rat) (pPM-C-His)
PV301085 500 ng

RGD1565796 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Mycobacterium Avium prfB Protein (aa 1-370)
VAng-Yyj2713-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Avium prfB Protein (aa 1-370)

Sign In for Pricing
View Details
TXLNA 3'UTR Luciferase Stable Cell Line
TU027565 1.0 mL

TXLNA 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Monkey CDKN2AIP N-Terminal Like Protein (CDKN2AIPNL) ELISA Kit
MBS7262599-01 48 Well

Monkey CDKN2AIP N-Terminal Like Protein (CDKN2AIPNL) ELISA Kit

Sign In for Pricing
View Details
Monkey CDKN2AIP N-Terminal Like Protein (CDKN2AIPNL) ELISA Kit
MBS7262599-02 96 Well

Monkey CDKN2AIP N-Terminal Like Protein (CDKN2AIPNL) ELISA Kit

Sign In for Pricing
View Details