Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYT17 Rabbit pAb (APR25592N)

Product Specifications

Background

Plays a role in dendrite formation by melanocytes.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SYT17 Rabbit pAb (APR25592N) .

Synonyms

SYT17; sytXVII

Gene ID

51760

UniProt

Q9BSW7

Cellular Locus

Membrane, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 53kDa Observed MW: 54kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51760

Uniprot URL

https://www.uniprot.org/uniprot/Q9BSW7

AA Sequence

KPIEFGVLSAKKEPIQPSVLRRTYNPDDYFRKFEPHLYSLDSNSDDVDSLTDEEILSKYQLGMLHFSTQYDLLHNHLTVRVIEARDLPPPISHDGSRQDMAHSNPYVKICLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVSVPLCEVDLVKGGHWWKALIPSSQNEVELGELLLSLNYLPSAGRLNVDVIRAKQLLQTDVSQGSDPFVKIQLVHGLKLVKTKKTSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSNDFIGRIVIGQYSSGPSETNHWRRMLNTHRTAVEQWHSLRSRAECDRVSPASLEVT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDCP1, CT (CDCP1, TRASK, CUB domain-containing protein 1, Membrane glycoprotein gp140, Subtractive immunization M plus HEp3-associated 135kD protein, Transmembrane and associated with src kinases, CD318) (MaxLight 750)
MBS6284059-01 0.1 mL

CDCP1, CT (CDCP1, TRASK, CUB domain-containing protein 1, Membrane glycoprotein gp140, Subtractive immunization M plus HEp3-associated 135kD protein, Transmembrane and associated with src kinases, CD318) (MaxLight 750)

Sign In for Pricing
View Details
CDCP1, CT (CDCP1, TRASK, CUB domain-containing protein 1, Membrane glycoprotein gp140, Subtractive immunization M plus HEp3-associated 135kD protein, Transmembrane and associated with src kinases, CD318) (MaxLight 750)
MBS6284059-02 5x 0.1 mL

CDCP1, CT (CDCP1, TRASK, CUB domain-containing protein 1, Membrane glycoprotein gp140, Subtractive immunization M plus HEp3-associated 135kD protein, Transmembrane and associated with src kinases, CD318) (MaxLight 750)

Sign In for Pricing
View Details
CD1C Rabbit Monoclonal Antibody
TA424027 100 µL

CD1C Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal HBXIP Antibody
NBP1-53103 100 µL

Rabbit Polyclonal HBXIP Antibody

Sign In for Pricing
View Details
DUSP13 Polyclonal Antibody, APC-Cy7 Conjugated
bs-7797R-APC-Cy7 100 µL

DUSP13 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
DUSP23 Mouse Monoclonal Antibody [Clone ID: LBI3C10]
AMM12051VCF 100 µg

DUSP23 Mouse Monoclonal Antibody [Clone ID: LBI3C10]

Sign In for Pricing
View Details