Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYT17 Rabbit pAb (APR25592N)

Product Specifications

Background

Plays a role in dendrite formation by melanocytes.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SYT17 Rabbit pAb (APR25592N) .

Synonyms

SYT17; sytXVII

Gene ID

51760

UniProt

Q9BSW7

Cellular Locus

Membrane, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 53kDa Observed MW: 54kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51760

Uniprot URL

https://www.uniprot.org/uniprot/Q9BSW7

AA Sequence

KPIEFGVLSAKKEPIQPSVLRRTYNPDDYFRKFEPHLYSLDSNSDDVDSLTDEEILSKYQLGMLHFSTQYDLLHNHLTVRVIEARDLPPPISHDGSRQDMAHSNPYVKICLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVSVPLCEVDLVKGGHWWKALIPSSQNEVELGELLLSLNYLPSAGRLNVDVIRAKQLLQTDVSQGSDPFVKIQLVHGLKLVKTKKTSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSNDFIGRIVIGQYSSGPSETNHWRRMLNTHRTAVEQWHSLRSRAECDRVSPASLEVT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM188B siRNA (Mouse)
CRN4634-01 15 nmol

FAM188B siRNA (Mouse)

Sign In for Pricing
View Details
FAM188B siRNA (Mouse)
CRN4634-02 30 nmol

FAM188B siRNA (Mouse)

Sign In for Pricing
View Details
Dog C-C motif chemokine 26 (CCL26) Elisa Kit
EK762095 96 Well

Dog C-C motif chemokine 26 (CCL26) Elisa Kit

Sign In for Pricing
View Details
Arl14 (NM_027843) Mouse Tagged ORF Clone Lentiviral Particle
MR217285L3V 200 µL

Arl14 (NM_027843) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Neospora Caninum gp65
369242 100 µg

Neospora Caninum gp65

Sign In for Pricing
View Details
MSH3 (Divergent Upstream Protein, DNA Mismatch Repair Protein, DNA Mismatch Repair Protein Msh 3, DNA Mismatch Repair Protein Msh3, DUC 1, DUC1, DUG, DUP, HMSH3, Mismatch Repair Protein 1, MRP 1, MRP1, MSH 3, MSH3_HUMAN, MutS Homolog 3 (E. coli), MutS Homolog 3)
324483-01 50 µL

MSH3 (Divergent Upstream Protein, DNA Mismatch Repair Protein, DNA Mismatch Repair Protein Msh 3, DNA Mismatch Repair Protein Msh3, DUC 1, DUC1, DUG, DUP, HMSH3, Mismatch Repair Protein 1, MRP 1, MRP1, MSH 3, MSH3_HUMAN, MutS Homolog 3 (E. coli), MutS Homolog 3)

Sign In for Pricing
View Details