Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOP58 Rabbit pAb (APR25590N)

Product Specifications

Background

The protein encoded by this gene is a core component of box C/D small nucleolar ribonucleoproteins. Some box C/D small nucleolar RNAs (snoRNAs), such as U3, U8, and U14, are dependent upon the encoded protein for their synthesis. This protein is SUMOylated, which is necessary for high affinity binding to snoRNAs.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NOP58 Rabbit pAb (APR25590N) .

Synonyms

NOP58; HSPC120; NOP5; NOP5/NOP58

Gene ID

51602

UniProt

Q9Y2X3

Cellular Locus

Nucleus, nucleolus, nucleoplasm

Applications

IF (U-251MG) IP (U-251MG)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 59kDa Observed MW: 65KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51602

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y2X3

AA Sequence

RMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYEHKSEVKTYDPSGDSTLPTCSKKRKIEQVDKEDEITEKKAKKAKIKVKVEEEEEEKVAEEEETSVKKKKKRGKKKHIKEEPLSEEEPCTSTAIASPEKKKKKKKKRENED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
BNC400977-500 1x 500 µL

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL
BNC400978-100 1x 100 µL

CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL
BNC401050-100 1x 100 µL

CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF405S conjugate, 0.1mg/mL
BNC040151-100 1x 100 µL

CD11a (Cris-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF740 conjugate, 0.1mg/mL
BNC740032-500 1x 500 µL

MUC2 (CCP58), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF740 conjugate, 0.1mg/mL
BNC740645-500 1x 500 µL

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details