Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFT81 Rabbit pAb (APR25577N)

Product Specifications

Background

The protein encoded by this gene, together with IFT74, forms a tubulin-binding module of intraflagellar transport complex B. This module is involved in transport of tubulin within the cilium, and the encoded protein is required for ciliogenesis. Mutations in this gene are a cause of short-rib polydactyly syndromes.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IFT81 Rabbit pAb (APR25577N) .

Synonyms

IFT81; CDV-1; CDV-1R; CDV1; CDV1R; DV1

Gene ID

28981

UniProt

Q8WYA0

Cellular Locus

Cell projection, cilium

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa/50kDa/79kDa Observed MW: 79kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=28981

Uniprot URL

https://www.uniprot.org/uniprot/Q8WYA0

AA Sequence

VRRLREECLQEESRYHYTNCMIKNLEVQLRRATDEMKAYISSDQQEKRKAIREQYTKNTAEQENLGKKLREKQKVIRESHGPNMKQAKMWRDLEQLMECKKQCFLKQQSQTSIGQVIQEGGEDRLIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTGR2 cDNA Clone
MBS1278624-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

PTGR2 cDNA Clone

Sign In for Pricing
View Details
PTGR2 cDNA Clone
MBS1278624-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

PTGR2 cDNA Clone

Sign In for Pricing
View Details
SF1 Protein Vector (Human) (pPM-C-HA)
43561021 500 ng

SF1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Bromotetramisole, L- (-) oxalate
bs-82305C-01 5 mg

Bromotetramisole, L- (-) oxalate

Sign In for Pricing
View Details
Bromotetramisole, L- (-) oxalate
bs-82305C-02 25 mg

Bromotetramisole, L- (-) oxalate

Sign In for Pricing
View Details
IGFBP5 rabbit polyclonal antibody, Biotin
AP01139BT-N 50 µg

IGFBP5 rabbit polyclonal antibody, Biotin

Sign In for Pricing
View Details