Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS28 Rabbit pAb (APR25576N)

Product Specifications

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that has been called mitochondrial ribosomal protein S35 in the literature.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MRPS28 Rabbit pAb (APR25576N) .

Synonyms

MRPS28; HSPC007; MRP-S28; MRP-S35; MRPS35

Gene ID

28957

UniProt

Q9Y2Q9

Cellular Locus

Mitochondrion

Dilution

WB 1:500 - 1:1000 IF 1:20 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 20kDa Observed MW: 21kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=28957

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y2Q9

AA Sequence

MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQKGSPKNVESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGIQESKDSRSKEEHHEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnf138 (NM_019706) Mouse Tagged ORF Clone
MG202240 10 µg

Rnf138 (NM_019706) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CCDC85C (NM_001144995) Human Over-expression Lysate
LY428630 100 µg

CCDC85C (NM_001144995) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PPP1R16A activation kit by CRISPRa
GA113819 1 Kit

Human PPP1R16A activation kit by CRISPRa

Sign In for Pricing
View Details
KIAA1310 (KANSL3) (Center) Rabbit Polyclonal Antibody
AP52348PU-N 400 µL

KIAA1310 (KANSL3) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
INSL4 (NM_002195) Human Over-expression Lysate
LC419478 20 µg

INSL4 (NM_002195) Human Over-expression Lysate

Sign In for Pricing
View Details
EnzyChrom™ Nitric Oxide Synthase Assay Kit
ENOS-100 100 Tests

EnzyChrom™ Nitric Oxide Synthase Assay Kit

Sign In for Pricing
View Details