Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD2 Rabbit pAb (APR25565N)

Product Specifications

Background

This gene encodes a protein that belongs to the muscle ankyrin repeat protein (MARP) family. A similar gene in rodents is a component of a muscle stress response pathway and plays a role in the stretch-response associated with slow muscle function. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ANKRD2 Rabbit pAb (APR25565N) .

Synonyms

ANKRD2; ARPP

Gene ID

26287

UniProt

Q9GZV1

Cellular Locus

Cytoplasm, I band, Nucleus, PML body, cytosol, myofibril, sarcomere

Dilution

WB 1:1000 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 36kDa/39kDa Observed MW: 42kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=26287

Uniprot URL

https://www.uniprot.org/uniprot/Q9GZV1

AA Sequence

GTMEDSEAVQRATALIEQRLAQEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SGKL (Serum/Glucocorticoid Regulated Kinase Family, Member 3, CISK, DKFZp781N0293, SGK2, SGKL) (PE)
MBS6183938-01 0.1 mL

SGKL (Serum/Glucocorticoid Regulated Kinase Family, Member 3, CISK, DKFZp781N0293, SGK2, SGKL) (PE)

Sign In for Pricing
View Details
SGKL (Serum/Glucocorticoid Regulated Kinase Family, Member 3, CISK, DKFZp781N0293, SGK2, SGKL) (PE)
MBS6183938-02 5x 0.1 mL

SGKL (Serum/Glucocorticoid Regulated Kinase Family, Member 3, CISK, DKFZp781N0293, SGK2, SGKL) (PE)

Sign In for Pricing
View Details
INO80B 3'UTR Lenti-reporter-Luc Vector
24973081 1.0 µg

INO80B 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Canine soluble tumor necrosis factor receptor 1 (sTNF-R1) ELISA Kit
MBS9313682-01 48 Well

Canine soluble tumor necrosis factor receptor 1 (sTNF-R1) ELISA Kit

Sign In for Pricing
View Details
Canine soluble tumor necrosis factor receptor 1 (sTNF-R1) ELISA Kit
MBS9313682-02 96 Well

Canine soluble tumor necrosis factor receptor 1 (sTNF-R1) ELISA Kit

Sign In for Pricing
View Details
Canine soluble tumor necrosis factor receptor 1 (sTNF-R1) ELISA Kit
MBS9313682-03 5x 96 Well

Canine soluble tumor necrosis factor receptor 1 (sTNF-R1) ELISA Kit

Sign In for Pricing
View Details