Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA14 Rabbit pAb (APR25550N)

Product Specifications

Background

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA XIV is predicted to be a type I membrane protein and shares highest sequence similarity with the other transmembrane CA isoform, CA XII; however, they have different patterns of tissue-specific expression and thus may play different physiologic roles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CA14 Rabbit pAb (APR25550N) .

Synonyms

CA14; CAXiV

Gene ID

23632

UniProt

Q9ULX7

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 37kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23632

Uniprot URL

https://www.uniprot.org/uniprot/Q9ULX7

AA Sequence

ADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB25 Protein Lysate (Rat) with C-HA Tag
38313036 100 µg

RAB25 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
ISO20560PM-165X90-GEMENGD GAS Pipe Markers for Gases
316740 1 Pack (1 Marker (s) x 1 Card)

ISO20560PM-165X90-GEMENGD GAS Pipe Markers for Gases

Sign In for Pricing
View Details
CG064, ID (RBM48, C7orf64, RNA-binding protein 48) (AP)
MBS6285425-01 0.2 mL

CG064, ID (RBM48, C7orf64, RNA-binding protein 48) (AP)

Sign In for Pricing
View Details
CG064, ID (RBM48, C7orf64, RNA-binding protein 48) (AP)
MBS6285425-02 5x 0.2 mL

CG064, ID (RBM48, C7orf64, RNA-binding protein 48) (AP)

Sign In for Pricing
View Details
D5Ertd579e CRISPR Activation Plasmid (m)
sc-435799-ACT 20 µg

D5Ertd579e CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Coiled-Coil Domain Containing 22 (CCDC22) Antibody
abx146283-01 100 µg

Coiled-Coil Domain Containing 22 (CCDC22) Antibody

Sign In for Pricing
View Details