Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CORO1C Rabbit pAb (APR25549N)

Product Specifications

Background

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Three transcript variants encoding two different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CORO1C Rabbit pAb (APR25549N) .

Synonyms

CORO1C; HCRNN4

Gene ID

23603

UniProt

Q9ULV4

Cellular Locus

Cell membrane, Cell projection, Cytoplasm, cytoskeleton, lamellipodium

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 53kDa/54kDa/58kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23603

Uniprot URL

https://www.uniprot.org/uniprot/Q9ULV4

AA Sequence

EEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Ovary
CB602811 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF405S conjugate, 0.1mg/mL
BNC042993-100 1x 100 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(S)-Naproxen Ethyl Ester
TRC-N377545-1G 1 g

(S)-Naproxen Ethyl Ester

Sign In for Pricing
View Details
1,4-Dihydro-4-oxo-3-quinolinecarboxylic Acid Ethyl Ester
TRC-D449740-25G 25 g

1,4-Dihydro-4-oxo-3-quinolinecarboxylic Acid Ethyl Ester

Sign In for Pricing
View Details
FITC Conjugated Goat Affinity Purified Antibody to Human IgG,
FAF-001-2 2 mL

FITC Conjugated Goat Affinity Purified Antibody to Human IgG,

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker) (GATA3/2442), CF405S conjugate, 0.1mg/mL
BNC042442-500 1x 500 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2442), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details