What is the catalog number for CLASP2 Rabbit pAb (APR25538N)?

The catalog number for CLASP2 Rabbit pAb (APR25538N) is APR25538N.

What sizes are available for CLASP2 Rabbit pAb (APR25538N)?

CLASP2 Rabbit pAb (APR25538N) is available in the following size(s): 50 µL, 100 µL, 200 µL.

How many pack sizes does CLASP2 Rabbit pAb (APR25538N) come in?

CLASP2 Rabbit pAb (APR25538N) is available in 3 different pack sizes.

Is CLASP2 Rabbit pAb (APR25538N) in stock?

CLASP2 Rabbit pAb (APR25538N) is currently made to order / not held in immediate stock. Contact us for lead time.

CLASP2 Rabbit pAb (APR25538N)

Product Specifications

Background

Microtubule plus-end tracking protein that promotes the stabilization of dynamic microtubules. Involved in the nucleation of noncentrosomal microtubules originating from the trans-Golgi network (TGN. Required for the polarization of the cytoplasmic microtubule arrays in migrating cells towards the leading edge of the cell. May act at the cell cortex to enhance the frequency of rescue of depolymerizing microtubules by attaching their plus-ends to cortical platforms composed of ERC1 and PHLDB2. This cortical microtubule stabilizing activity is regulated at least in part by phosphatidylinositol 3-kinase signaling. Also performs a similar stabilizing function at the kinetochore which is essential for the bipolar alignment of chromosomes on the mitotic spindle. Acts as a mediator of ERBB2-dependent stabilization of microtubules at the cell cortex.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CLASP2 Rabbit pAb (APR25538N) .

Synonyms

CLASP2

Gene ID

23122

UniProt

O75122

Cellular Locus

Cell membrane, Cell projection, Chromosome, Cytoplasm, Golgi apparatus, centromere, centrosome, cytoskeleton, kinetochore, microtubule organizing center, ruffle membrane, spindle, trans-Golgi network

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 46kDa/141kDa/165kDa Observed MW: 141kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23122

Uniprot URL

https://www.uniprot.org/uniprot/O75122

AA Sequence

NCTSKSVPVRRRSFEFLDLLLQEWQTHSLERHAAVLVETIKKGIHDADAEARVEARKTYMGLRNHFPGEAETLYNSLEPSYQKSLQTYLKSSGSVASLPQSDRSSSSSQESLNRPFSSKWSTANPSTVAGRVSAGSSKASSLPGSLQRSRSDIDVNAAAGAKAHHAAGQSVRSGRLGAGAL