Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3M Rabbit pAb (APR25504N)

Product Specifications

Background

This gene encodes a protein that is part of the eurkaryotic translation initiation factor 3 complete (eIF-3) required for protein synthesis. Elevated levels of the encoded protein are present in cancer cell lines. Inactivation of the encoded protein has been shown to interfere with translation of herpes virus mRNAs by preventing the association of mRNAs with the ribosomes. A pseudogene of this gene is located on the X chromosome.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EIF3M Rabbit pAb (APR25504N) .

Synonyms

EIF3M; B5; GA17; PCID1; TANGO7; hfl-B5

Gene ID

10480

UniProt

Q7L2H7

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 27kDa/42kDa Observed MW: 40kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10480

Uniprot URL

https://www.uniprot.org/uniprot/Q7L2H7

AA Sequence

MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kallikrein 8 (KLK8) Mouse Monoclonal Antibody [Clone:3E6]
E45M15132 100 µg

Kallikrein 8 (KLK8) Mouse Monoclonal Antibody [Clone:3E6]

Sign In for Pricing
View Details
Rabbit Polyclonal MEX3C Antibody [Alexa Fluor 405]
NBP1-76341AF405 0.1 mL

Rabbit Polyclonal MEX3C Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
5-Phenylvaleric Acid
M20840-01 1 g

5-Phenylvaleric Acid

Sign In for Pricing
View Details
5-Phenylvaleric Acid
M20840-02 200 mg

5-Phenylvaleric Acid

Sign In for Pricing
View Details
5-Phenylvaleric Acid
M20840-03 10 mg

5-Phenylvaleric Acid

Sign In for Pricing
View Details
5-Phenylvaleric Acid
M20840-04 25 mg

5-Phenylvaleric Acid

Sign In for Pricing
View Details