Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3M Rabbit pAb (APR25504N)

Product Specifications

Background

This gene encodes a protein that is part of the eurkaryotic translation initiation factor 3 complete (eIF-3) required for protein synthesis. Elevated levels of the encoded protein are present in cancer cell lines. Inactivation of the encoded protein has been shown to interfere with translation of herpes virus mRNAs by preventing the association of mRNAs with the ribosomes. A pseudogene of this gene is located on the X chromosome.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EIF3M Rabbit pAb (APR25504N) .

Synonyms

EIF3M; B5; GA17; PCID1; TANGO7; hfl-B5

Gene ID

10480

UniProt

Q7L2H7

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 27kDa/42kDa Observed MW: 40kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10480

Uniprot URL

https://www.uniprot.org/uniprot/Q7L2H7

AA Sequence

MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Arginase 1/ARG1/liver Arginase Antibody
NBP1-54621 100 µL

Rabbit Polyclonal Arginase 1/ARG1/liver Arginase Antibody

Sign In for Pricing
View Details
FOLH1B (NM_153696) Human Tagged ORF Clone
RC213038 10 µg

FOLH1B (NM_153696) Human Tagged ORF Clone

Sign In for Pricing
View Details
ADM Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-0007R-BF555-TR 20 µL

ADM Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Bovine Bestrophin 3 (BEST3) ELISA kit
GTR10374802 96 Well

Bovine Bestrophin 3 (BEST3) ELISA kit

Sign In for Pricing
View Details
Lentiviral mouse Nrsn2 shRNA (UAS) - Lentiviral mouse Nrsn2 shRNA (UAS, RFP) (25)
GTR15147719 1 Vial

Lentiviral mouse Nrsn2 shRNA (UAS) - Lentiviral mouse Nrsn2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
NUFIP1 Rabbit Polyclonal Antibody (Carrier-free)
orb3096681 100 µg

NUFIP1 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details