Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUBGCP3 Rabbit pAb (APR25499N)

Product Specifications

Background

Gamma-tubulin complex is necessary for microtubule nucleation at the centrosome.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TUBGCP3 Rabbit pAb (APR25499N) .

Synonyms

TUBGCP3; 104p; GCP3; Grip104; SPBC98; Spc98; Spc98p

Gene ID

10426

UniProt

Q96CW5

Cellular Locus

Cytoplasm, centrosome, cytoskeleton, microtubule organizing center

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 48kDa/93kDa/103kDa Observed MW: 105kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10426

Uniprot URL

https://www.uniprot.org/uniprot/Q96CW5

AA Sequence

MATPDQKSPNVLLQNLCCRILGRSEADVAQQFQYAVRVIGSNFAPTVERDEFLVAEKIKKELIRQRREADAALFSELHRKLHSQGVLKNKWSILYLLLSLSEDPRRQPSKVSSYATLFAQALPRDAHSTPYYYARPQTLPLSYQDRSAQSAQSSGSVGSSGISSIGLCALSGPAPAPQSLLPGQSNQAPGVGDCLRQQLGSRLAWTLTANQPSSQATTSKGVPSAVSRNMTRSRREGDTGGTMEITEAAL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTND6P6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV735451 1.0 µg DNA

MTND6P6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Energy Transfer Kit, Malvern
1050100/7 1 Each

Energy Transfer Kit, Malvern

Sign In for Pricing
View Details
Human Anti-Granulocyte-Macrophage Colony-Stimulating Factor Antibody (Anti-CSF2) ELISA Kit
abx585614-01 96 Tests

Human Anti-Granulocyte-Macrophage Colony-Stimulating Factor Antibody (Anti-CSF2) ELISA Kit

Sign In for Pricing
View Details
Human Anti-Granulocyte-Macrophage Colony-Stimulating Factor Antibody (Anti-CSF2) ELISA Kit
abx585614-02 5x 96 Tests

Human Anti-Granulocyte-Macrophage Colony-Stimulating Factor Antibody (Anti-CSF2) ELISA Kit

Sign In for Pricing
View Details
Human Anti-Granulocyte-Macrophage Colony-Stimulating Factor Antibody (Anti-CSF2) ELISA Kit
abx585614-03 10x 96 Tests

Human Anti-Granulocyte-Macrophage Colony-Stimulating Factor Antibody (Anti-CSF2) ELISA Kit

Sign In for Pricing
View Details
CMPK1 Mouse Monoclonal Antibody [Clone ID: LBI1A1]
AMM13139VCF 100 µg

CMPK1 Mouse Monoclonal Antibody [Clone ID: LBI1A1]

Sign In for Pricing
View Details