Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USH1C Rabbit pAb (APR25487N)

Product Specifications

Background

This gene encodes a scaffold protein that functions in the assembly of Usher protein complexes. The protein contains PDZ domains, a coiled-coil region with a bipartite nuclear localization signal and a PEST degradation sequence. Defects in this gene are the cause of Usher syndrome type 1C and non-syndromic sensorineural deafness autosomal recessive type 18. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality USH1C Rabbit pAb (APR25487N) .

Synonyms

USH1C; AIE-75; DFNB18; DFNB18A; NY-CO-37; NY-CO-38; PDZ-45; PDZ-73; PDZ-73/NY-CO-38; PDZ73; PDZD7C; ush1cpst; harmonin

Gene ID

564412

Cellular Locus

Cytoplasm, cytoskeleton, cytosol

Dilution

WB 1:200 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 45kDa/58kDa/60kDa/62kDa/101kDa Observed MW: 73kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=564412

AA Sequence

MERKVAREFRHKVELLIDNEAEKDYLYDVLRMYHQSMDLPVLVGDLKLVINEPKRLPLFDAIRPLIPLKHQVQYDQLTPKRSRKLKEVRLDRTHPEGLGL

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human GINS3 Knockout HEK293T cell line
GTR15408607 1 Vial

Human GINS3 Knockout HEK293T cell line

Ask
View Details
Phospho-MAP3K9+MAP3K10 (Thr312 + Thr266) Polyclonal Antibody, PE-Cy7 Conjugated
bs-6779R-PE-Cy7 100 µL

Phospho-MAP3K9+MAP3K10 (Thr312 + Thr266) Polyclonal Antibody, PE-Cy7 Conjugated

Ask
View Details
Rnf187 siRNA Oligos set (Rat)
40279176 3x 5 nmol

Rnf187 siRNA Oligos set (Rat)

Ask
View Details
PDGFRA, CT (E1063) (Alpha-type Platelet-derived Growth Factor Receptor, PDGF-R-alpha, CD140 Antigen-like Family Member A, CD140a Antigen, CD140a) (MaxLight 405)
MBS6493875-01 0.1 mL

PDGFRA, CT (E1063) (Alpha-type Platelet-derived Growth Factor Receptor, PDGF-R-alpha, CD140 Antigen-like Family Member A, CD140a Antigen, CD140a) (MaxLight 405)

Ask
View Details
PDGFRA, CT (E1063) (Alpha-type Platelet-derived Growth Factor Receptor, PDGF-R-alpha, CD140 Antigen-like Family Member A, CD140a Antigen, CD140a) (MaxLight 405)
MBS6493875-02 5x 0.1 mL

PDGFRA, CT (E1063) (Alpha-type Platelet-derived Growth Factor Receptor, PDGF-R-alpha, CD140 Antigen-like Family Member A, CD140a Antigen, CD140a) (MaxLight 405)

Ask
View Details