Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USH1C Rabbit pAb (APR25487N)

Product Specifications

Background

This gene encodes a scaffold protein that functions in the assembly of Usher protein complexes. The protein contains PDZ domains, a coiled-coil region with a bipartite nuclear localization signal and a PEST degradation sequence. Defects in this gene are the cause of Usher syndrome type 1C and non-syndromic sensorineural deafness autosomal recessive type 18. Multiple transcript variants encoding different isoforms have been found for this gene.

Synonyms

USH1C; AIE-75; DFNB18; DFNB18A; NY-CO-37; NY-CO-38; PDZ-45; PDZ-73; PDZ-73/NY-CO-38; PDZ73; PDZD7C; ush1cpst; harmonin

Gene ID

564412

Cellular Locus

Cytoplasm, cytoskeleton, cytosol

Dilution

WB 1:200 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 45kDa/58kDa/60kDa/62kDa/101kDa Observed MW: 73kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality USH1C Rabbit pAb (APR25487N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=564412

AA Sequence

MERKVAREFRHKVELLIDNEAEKDYLYDVLRMYHQSMDLPVLVGDLKLVINEPKRLPLFDAIRPLIPLKHQVQYDQLTPKRSRKLKEVRLDRTHPEGLGL

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PTPN14 CRISPRa sgRNA lentivector (set of three targets)(Rat)
38150126 3 x 1.0μg DNA

PTPN14 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Ask
View Details
Human IFN alpha Recombinant Protein C-Fc Tag Lyophilized
MBS8432269-01 0.05 mg

Human IFN alpha Recombinant Protein C-Fc Tag Lyophilized

Ask
View Details
Human IFN alpha Recombinant Protein C-Fc Tag Lyophilized
MBS8432269-02 5x 0.05 mg

Human IFN alpha Recombinant Protein C-Fc Tag Lyophilized

Ask
View Details
Gm4871 3'UTR Lenti-reporter-Luc Vector
22048084 1.0 μg

Gm4871 3'UTR Lenti-reporter-Luc Vector

Ask
View Details
IER2, ID (P113) (Immediate early response gene 2 protein, Protein ETR101, ETR101, IER2) (MaxLight 650)
MBS6309208-01 0.1 mL

IER2, ID (P113) (Immediate early response gene 2 protein, Protein ETR101, ETR101, IER2) (MaxLight 650)

Ask
View Details
IER2, ID (P113) (Immediate early response gene 2 protein, Protein ETR101, ETR101, IER2) (MaxLight 650)
MBS6309208-02 5x 0.1 mL

IER2, ID (P113) (Immediate early response gene 2 protein, Protein ETR101, ETR101, IER2) (MaxLight 650)

Ask
View Details