Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX46 Rabbit pAb (APR25484N)

Product Specifications

Background

This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a component of the 17S U2 snRNP complex; it plays an important role in pre-mRNA splicing. Multiple alternatively spliced transcript variants have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DDX46 Rabbit pAb (APR25484N) .

Synonyms

PRPF5; Prp5; DDX46

Gene ID

9879

UniProt

Q7L014

Cellular Locus

Cajal body, Lipid-anchor, Membrane, Nucleus, Nucleus speckle

Applications

WB (293T)

Dilution

WB 1:500 - 1:1000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 117kDa Observed MW: 117kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9879

Uniprot URL

https://www.uniprot.org/uniprot/Q7L014

AA Sequence

GLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQARYAGDIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSSGFSGKGFKFDETEQALANERKKLQKAALGLQDSDDEDAAVDIDEQIESMFNSKKRVKDMAAPGTSSVPAPTAGNAEKLEIAKRLALRINAQKNLGIESQDVMQQATNAILRGGTILAPTVSAKTIAEQLAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPPGKEPKEGERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Favezelimab ELISA Kit
KET-10712 96 Tests

Favezelimab ELISA Kit

Ask
View Details
Human TSH R MAb (Clone 484405)
MAB6534-SP 25 µg

Human TSH R MAb (Clone 484405)

Ask
View Details
Nori® Canine CG ELISA Kit
GR115080 96 Well

Nori® Canine CG ELISA Kit

Ask
View Details
VPS4B (Vacuolar Protein Sorting-Associated Protein 4B, Cell Migration-inducing Gene 1 Protein, Suppressor of K (+) Transport Growth Defect 1, Protein SKD1, SKD1, VPS42, MIG1)
339617-01 50 µL

VPS4B (Vacuolar Protein Sorting-Associated Protein 4B, Cell Migration-inducing Gene 1 Protein, Suppressor of K (+) Transport Growth Defect 1, Protein SKD1, SKD1, VPS42, MIG1)

Ask
View Details
VPS4B (Vacuolar Protein Sorting-Associated Protein 4B, Cell Migration-inducing Gene 1 Protein, Suppressor of K (+) Transport Growth Defect 1, Protein SKD1, SKD1, VPS42, MIG1)
339617-02 100 µL

VPS4B (Vacuolar Protein Sorting-Associated Protein 4B, Cell Migration-inducing Gene 1 Protein, Suppressor of K (+) Transport Growth Defect 1, Protein SKD1, SKD1, VPS42, MIG1)

Ask
View Details