Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNAP29 Rabbit pAb (APR25465N)

Product Specifications

Background

This gene, a member of the SNAP25 gene family, encodes a protein involved in multiple membrane trafficking steps. Two other members of this gene family, SNAP23 and SNAP25, encode proteins that bind a syntaxin protein and mediate synaptic vesicle membrane docking and fusion to the plasma membrane. The protein encoded by this gene binds tightly to multiple syntaxins and is localized to intracellular membrane structures rather than to the plasma membrane. While the protein is mostly membrane-bound, a significant fraction of it is found free in the cytoplasm. Use of multiple polyadenylation sites has been noted for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SNAP29 Rabbit pAb (APR25465N) .

Synonyms

SNAP29; CEDNIK; SNAP-29

Gene ID

9342

UniProt

O95721

Cellular Locus

Cell projection, Cytoplasm, Cytoplasmic vesicle, Golgi apparatus membrane, Peripheral membrane protein, autophagosome membrane, cilium membrane

Dilution

WB 1:1000 - 1:4000 IHC 1:50 - 1:200 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 28kDa Observed MW: 29kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9342

Uniprot URL

https://www.uniprot.org/uniprot/O95721

AA Sequence

MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cndp2 Mouse Gene Knockout Kit (CRISPR)
KN503535 1 Kit

Cndp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD4 Antibody[RPA-T4]
E-AB-F1109P-01 20 Tests

PE/Elab Fluor® 594 Anti-Human CD4 Antibody[RPA-T4]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD4 Antibody[RPA-T4]
E-AB-F1109P-02 100 Tests

PE/Elab Fluor® 594 Anti-Human CD4 Antibody[RPA-T4]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD4 Antibody[RPA-T4]
E-AB-F1109P-03 2x 100 Tests

PE/Elab Fluor® 594 Anti-Human CD4 Antibody[RPA-T4]

Sign In for Pricing
View Details
STARD5 Human Gene Knockout Kit (CRISPR)
KN402407 1 Kit

STARD5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NCF1 Antibody
KC-27749-01 50 μL

NCF1 Antibody

Sign In for Pricing
View Details