Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF1AY Rabbit pAb (APR25460N)

Product Specifications

Background

This gene is located on the non-recombining region of the Y chromosome. It encodes a protein related to eukaryotic translation initiation factor 1A (EIF1A), which may function in stabilizing the binding of the initiator Met-tRNA to 40S ribosomal subunits. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EIF1AY Rabbit pAb (APR25460N) .

Synonyms

EIF1AY; eIF-4C; Y-linked

Gene ID

9086

UniProt

O14602

Dilution

WB 1:200 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 16kDa Observed MW: 18kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9086

Uniprot URL

https://www.uniprot.org/uniprot/O14602

AA Sequence

MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human Histone H3 Polyclonal Antibody
PA88126HU-01 50 µg

Rabbit Anti-Human Histone H3 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Histone H3 Polyclonal Antibody
PA88126HU-02 100 µg

Rabbit Anti-Human Histone H3 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Histone H3 Polyclonal Antibody
PA88126HU-03 500 µg

Rabbit Anti-Human Histone H3 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Histone H3 Polyclonal Antibody
PA88126HU-04 1 mg

Rabbit Anti-Human Histone H3 Polyclonal Antibody

Sign In for Pricing
View Details
1700031F05Rik CRISPRa sgRNA lentivector (set of three targets)(Mouse)
10222124 3x 1.0µg DNA

1700031F05Rik CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal Zinc finger protein 324B Antibody
NBP1-92614-25ul 25 µL

Rabbit Polyclonal Zinc finger protein 324B Antibody

Sign In for Pricing
View Details