Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMELESS Rabbit pAb (APR25457N)

Product Specifications

Background

The protein encoded by this gene is highly conserved and is involved in cell survival after damage or stress, increase in DNA polymerase epsilon activity, maintenance of telomere length, and epithelial cell morphogenesis. The encoded protein also plays a role in the circadian rhythm autoregulatory loop, interacting with the PERIOD genes (PER1, PER2, and PER3) and others to downregulate activation of PER1 by CLOCK/ARNTL. Changes in this gene or its expression may promote prostate cancer, lung cancer, breast cancer, and mental disorders.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TIMELESS Rabbit pAb (APR25457N) .

Synonyms

TIMELESS; TIM; TIM1; hTIM

Gene ID

8914

UniProt

Q9UNS1

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 138kDa Observed MW: 160kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8914

Uniprot URL

https://www.uniprot.org/uniprot/Q9UNS1

AA Sequence

EDLEEEENLPEEDSEEEEEGGSEAEQVQGSLVLSNENLGQSLHQEGFSIPLLWLQNCLIRAADDREEDGCSQAVPLVPLTEENEEAMENEQFQQLLRKLGVRPPASGQETFWRIPAKLSPTQLRRAAASLSQPEEEQKLQPELQPKVPGEQGSDEEHCKEHRAQALRALLLAHKKKAGLASPEEEDAVGKEPLKAAPKKRQLLDSDEEQEEDEGRNRAPELGAPGIQKKKRYQIEDDEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WM-T2-PK Adhesive-backed Markers
112465 900 Pack (36 Label (s) x 25 Card)

WM-T2-PK Adhesive-backed Markers

Sign In for Pricing
View Details
Mouse Monoclonal TrkB Antibody (10B6C4)
NBP2-52524-0.025mg 0.025 mg

Mouse Monoclonal TrkB Antibody (10B6C4)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1)
MBS2165819-01 0.1 mL

APC-Linked Monoclonal Antibody to Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1)
MBS2165819-02 0.2 mL

APC-Linked Monoclonal Antibody to Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1)
MBS2165819-03 0.5 mL

APC-Linked Monoclonal Antibody to Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1)
MBS2165819-04 1 mL

APC-Linked Monoclonal Antibody to Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1)

Sign In for Pricing
View Details