Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFITM1 Rabbit pAb (APR25449N)

Product Specifications

Background

IFN-induced antiviral protein which inhibits the entry of viruses to the host cell cytoplasm, permitting endocytosis, but preventing subsequent viral fusion and release of viral contents into the cytosol. Active against multiple viruses, including influenza A virus, SARS coronaviruses (SARS-CoV and SARS-CoV-2, Marburg virus (MARV, Ebola virus (EBOV, Dengue virus (DNV, West Nile virus (WNV, human immunodeficiency virus type 1 (HIV-1 and hepatitis C virus (HCV. Can inhibit: influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry and SARS-CoV and SARS-CoV-2 S protein-mediated viral entry. Also implicated in cell adhesion and control of cell growth and migration. Inhibits SARS-CoV-2 S protein-mediated syncytia formation. Plays a key role in the antiproliferative action of IFN-gamma either by inhibiting the ERK activation or by arresting cell growth in G1 phase in a p53-dependent manner. Acts as a positive regulator of osteoblast differentiation. In hepatocytes, IFITM proteins act in a coordinated manner to restrict HCV infection by targeting the endocytosed HCV virion for lysosomal degradation. IFITM2 and IFITM3 display anti-HCV activity that may complement the anti-HCV activity of IFITM1 by inhibiting the late stages of HCV entry, possibly in a coordinated manner by trapping the virion in the endosomal pathway and targeting it for degradation at the lysosome.

Synonyms

IFITM1; 9-27; CD225; DSPA2a; IFI17; LEU13

Gene ID

8519

UniProt

P13164

Cellular Locus

Cell membrane, Single-pass membrane protein

Applications

WB (Homo sapiens)

Dilution

WB 1:200 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa Observed MW: 17kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IFITM1 Rabbit pAb (APR25449N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8519

Uniprot URL

https://www.uniprot.org/uniprot/P13164

AA Sequence

CCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

QSOX1 Protein Lysate (Rat) with C-HA Tag
38278036 100 μg

QSOX1 Protein Lysate (Rat) with C-HA Tag

Ask
View Details
Porcine Heat Shock 70kDa Protein 1A (HSPA1A) ELISA Kit
DLR-HSPA1A-p-48T 48 Tests

Porcine Heat Shock 70kDa Protein 1A (HSPA1A) ELISA Kit

Ask
View Details
Rabbit Monoclonal Lumican Antibody (110) [DyLight 488]
NBP2-89942G 0.1 mL

Rabbit Monoclonal Lumican Antibody (110) [DyLight 488]

Ask
View Details
Recombinant Xanthomonas axonopodis pv. citri DNA ligase (ligA), partial
MBS1337703 Inquire

Recombinant Xanthomonas axonopodis pv. citri DNA ligase (ligA), partial

Ask
View Details