Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK2AP1 Rabbit pAb (APR25442N)

Product Specifications

Background

The protein encoded by this gene is a cyclin-dependent kinase 2 (CDK2) -associated protein which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggests a regulatory role in DNA replication during the S-phase of the cell cycle. This protein also forms a core subunit of the nucleosome remodeling and histone deacetylation (NURD) complex that epigenetically regulates embryonic stem cell differentiation. This gene thus plays a role in both cell-cycle and epigenetic regulation. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CDK2AP1 Rabbit pAb (APR25442N) .

Synonyms

CDK2AP1; DOC1; DORC1; ST19; doc-1; p12DOC-1

Gene ID

8099

UniProt

O14519

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 9kDa/12kDa Observed MW: 12kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8099

Uniprot URL

https://www.uniprot.org/uniprot/O14519

AA Sequence

MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal FTSJ2 Antibody
NBP3-12592-50ul 50 µL

Rabbit Polyclonal FTSJ2 Antibody

Sign In for Pricing
View Details
AMIGO2 Adenovirus (Human)
11838051 1.0 mL

AMIGO2 Adenovirus (Human)

Sign In for Pricing
View Details
Rabbit Monoclonal Villin 1 Antibody (VIL1/4107R) [Alexa Fluor 647]
NBP3-08935AF647 100 µL

Rabbit Monoclonal Villin 1 Antibody (VIL1/4107R) [Alexa Fluor 647]

Sign In for Pricing
View Details
Human Dyslexia-associated protein KIAA0319-like protein (KIAA0319L) ELISA Kit
RK11335 96 Tests

Human Dyslexia-associated protein KIAA0319-like protein (KIAA0319L) ELISA Kit

Sign In for Pricing
View Details
TSHB Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-2676R-BF594-01 20 µL

TSHB Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
TSHB Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-2676R-BF594-02 100 µL

TSHB Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details