Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLN1 Rabbit pAb (APR25426N)

Product Specifications

Background

This gene encodes a cytoskeletal protein that is concentrated in areas of cell-substratum and cell-cell contacts. The encoded protein plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. It codistributes with integrins in the cell surface membrane in order to assist in the attachment of adherent cells to extracellular matrices and of lymphocytes to other cells. The N-terminus of this protein contains elements for localization to cell-extracellular matrix junctions. The C-terminus contains binding sites for proteins such as beta-1-integrin, actin, and vinculin.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TLN1 Rabbit pAb (APR25426N) .

Synonyms

TLN1; ILWEQ; TLN; talin-1

Gene ID

7094

UniProt

Q9Y490

Cellular Locus

Cell junction, Cell projection, Cell surface, Cytoplasm, Cytoplasmic side, Peripheral membrane protein, cytoskeleton, focal adhesion, ruffle membrane

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 269kDa Observed MW: 240kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7094

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y490

AA Sequence

MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEAPAGPPSDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKEEITGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQAR

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HRP-Linked Polyclonal Antibody to Solute Carrier Family 30, Member 5 (SLC30A5)
MBS2078376-01 0.1 mL

HRP-Linked Polyclonal Antibody to Solute Carrier Family 30, Member 5 (SLC30A5)

Ask
View Details
HRP-Linked Polyclonal Antibody to Solute Carrier Family 30, Member 5 (SLC30A5)
MBS2078376-02 0.2 mL

HRP-Linked Polyclonal Antibody to Solute Carrier Family 30, Member 5 (SLC30A5)

Ask
View Details
HRP-Linked Polyclonal Antibody to Solute Carrier Family 30, Member 5 (SLC30A5)
MBS2078376-03 0.5 mL

HRP-Linked Polyclonal Antibody to Solute Carrier Family 30, Member 5 (SLC30A5)

Ask
View Details
HRP-Linked Polyclonal Antibody to Solute Carrier Family 30, Member 5 (SLC30A5)
MBS2078376-04 1 mL

HRP-Linked Polyclonal Antibody to Solute Carrier Family 30, Member 5 (SLC30A5)

Ask
View Details
HRP-Linked Polyclonal Antibody to Solute Carrier Family 30, Member 5 (SLC30A5)
MBS2078376-05 5 mL

HRP-Linked Polyclonal Antibody to Solute Carrier Family 30, Member 5 (SLC30A5)

Ask
View Details
HRP-Linked Polyclonal Antibody to Solute Carrier Family 30, Member 5 (SLC30A5)
MBS2078376-06 5x 5 mL

HRP-Linked Polyclonal Antibody to Solute Carrier Family 30, Member 5 (SLC30A5)

Ask
View Details