Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNLT1 Rabbit pAb (APR25421N)

Product Specifications

Background

This gene encodes a component of the motor complex, cytoplasmic dynein, which transports cellular cargo along microtubules in the cell. The encoded protein regulates the length of primary cilia which are sensory organelles found on the surface of cells. The protein encoded by this gene interacts with viral proteins, like the minor capsid protein L2 of human papillomavirus, and is required for dynein-mediated delivery of the viral nucleic acid to the host nucleus. This protein interacts with oncogenic nucleoporins to disrupt gene regulation and cause leukemic transformation. Pseudogenes of this gene are present on chromosomes 4 and 17. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DYNLT1 Rabbit pAb (APR25421N) .

Synonyms

DYNLT1; CW-1; TCTEL1; tctex-1

Gene ID

6993

UniProt

P63172

Cellular Locus

Cytoplasm, Golgi apparatus, cytoskeleton, spindle

Applications

WB (Mus musculus)

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa Observed MW: 13kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6993

Uniprot URL

https://www.uniprot.org/uniprot/P63172

AA Sequence

MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubiquitin-Like-Conjugating Enzyme ATG3 (ATG3) Antibody
abx457250-01 50 µg

Ubiquitin-Like-Conjugating Enzyme ATG3 (ATG3) Antibody

Sign In for Pricing
View Details
Ubiquitin-Like-Conjugating Enzyme ATG3 (ATG3) Antibody
abx457250-02 100 µg

Ubiquitin-Like-Conjugating Enzyme ATG3 (ATG3) Antibody

Sign In for Pricing
View Details
Human vitronectin (VTN) Elisa Kit
EK700075 96 Well

Human vitronectin (VTN) Elisa Kit

Sign In for Pricing
View Details
1-Iodo-2,4-bis (trifluoromethyl) benzene
PC1012645-01 250 mg

1-Iodo-2,4-bis (trifluoromethyl) benzene

Sign In for Pricing
View Details
1-Iodo-2,4-bis (trifluoromethyl) benzene
PC1012645-02 500 mg

1-Iodo-2,4-bis (trifluoromethyl) benzene

Sign In for Pricing
View Details
C-Myc (human) Recombinant monoclonal antibody (9E10) (Human IgG3κ)
ENZ-ABS473-0200 200 µg

C-Myc (human) Recombinant monoclonal antibody (9E10) (Human IgG3κ)

Sign In for Pricing
View Details