Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSX5 Rabbit pAb (APR25415N)

Product Specifications

Background

The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneous humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. While some of the related SSX genes are involved in t (X;18) (p11.2; q11.2) translocations that are characteristically found in all synovial sarcomas, this gene does not appear to be involved in such translocations. Two transcript variants encoding distinct isoforms have been identified for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SSX5 Rabbit pAb (APR25415N) .

Synonyms

SSX5

Gene ID

6758

UniProt

O60225

Dilution

WB 1:200 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 21kDa/26kDa Observed MW: 30kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6758

Uniprot URL

https://www.uniprot.org/uniprot/O60225

AA Sequence

MNGDDAFVRRPRVGSQIPEKMQKHPWRQVCDRGIHLVNLSPFWKVGREPASSIKALLCGRGEARAFDDIAKYFSEKEWEKMKASEKIIYVYMKRKYEAMTKLGFKATLPPFMRNKRVADFQGNDFDNDPNRGNQVEHPQMTFGRLQGIFPKITPEKPAEEGNDSKGVPEASGPQNNGKQLRPSGKLNTSEKVNKTSGPKRGKHAWTHRVRERKQLVIYEEISDPQEDDE

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Uhrf1 (E3 Ubiquitin-Protein Ligase UHRF1, 632-, Nuclear Protein 95, Nuclear Zinc Finger Protein Np95, Ubiquitin-like PHD and RING Finger Domain-Containing Protein 1, mUhrf1, Ubiquitin-like-Containing PHD and RING Finger Domains Protein 1, Uhrf1, Np95) (Ma
MBS6460084-01 0.1 mL

Uhrf1 (E3 Ubiquitin-Protein Ligase UHRF1, 632-, Nuclear Protein 95, Nuclear Zinc Finger Protein Np95, Ubiquitin-like PHD and RING Finger Domain-Containing Protein 1, mUhrf1, Ubiquitin-like-Containing PHD and RING Finger Domains Protein 1, Uhrf1, Np95) (Ma

Ask
View Details
Uhrf1 (E3 Ubiquitin-Protein Ligase UHRF1, 632-, Nuclear Protein 95, Nuclear Zinc Finger Protein Np95, Ubiquitin-like PHD and RING Finger Domain-Containing Protein 1, mUhrf1, Ubiquitin-like-Containing PHD and RING Finger Domains Protein 1, Uhrf1, Np95) (Ma
MBS6460084-02 5x 0.1 mL

Uhrf1 (E3 Ubiquitin-Protein Ligase UHRF1, 632-, Nuclear Protein 95, Nuclear Zinc Finger Protein Np95, Ubiquitin-like PHD and RING Finger Domain-Containing Protein 1, mUhrf1, Ubiquitin-like-Containing PHD and RING Finger Domains Protein 1, Uhrf1, Np95) (Ma

Ask
View Details
GCMA Polyclonal Antibody, Cy7 Conjugated
bs-6306R-Cy7 100 µL

GCMA Polyclonal Antibody, Cy7 Conjugated

Ask
View Details
Rabbit Polyclonal EGFR Antibody [HRP]
NB100-596H 0.1 mL

Rabbit Polyclonal EGFR Antibody [HRP]

Ask
View Details
Rabbit Polyclonal LMX1A Antibody [CoraFluor 1]
NBP2-41193CL1 0.1 mL

Rabbit Polyclonal LMX1A Antibody [CoraFluor 1]

Ask
View Details
Human ATP5F1A Recombinant Protein (N-His)
HD604012-01 50 µg

Human ATP5F1A Recombinant Protein (N-His)

Ask
View Details