Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3GL3 Rabbit pAb (APR25410N)

Product Specifications

Background

Implicated in endocytosis. May recruit other proteins to membranes with high curvature (By similarity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SH3GL3 Rabbit pAb (APR25410N) .

Synonyms

SH3GL3; CNSA3; EEN-B2; HsT19371; SH3D2C; SH3P13

Gene ID

6457

UniProt

Q99963

Cellular Locus

Cytoplasm, Early endosome membrane, Peripheral membrane protein

Dilution

WB 1:500 - 1:4000 IHC 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 31kDa/38kDa/39kDa/40kDa Observed MW: 39kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6457

Uniprot URL

https://www.uniprot.org/uniprot/Q99963

AA Sequence

MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Sprouty 4 antibody
SL7421R-01 50 µL

Rabbit Anti-Sprouty 4 antibody

Sign In for Pricing
View Details
Rabbit Anti-Sprouty 4 antibody
SL7421R-02 100 µL

Rabbit Anti-Sprouty 4 antibody

Sign In for Pricing
View Details
Asb4 (NM_023048) Mouse Tagged ORF Clone Lentiviral Particle
MR206797L4V 200 µL

Asb4 (NM_023048) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ZNF548 (NM_152909) Human Recombinant Protein
E45H30468E6 50 µg

ZNF548 (NM_152909) Human Recombinant Protein

Sign In for Pricing
View Details
Ip6k2 (NM_021660) Rat Tagged Lenti ORF Clone
RR206446L4 10 µg

Ip6k2 (NM_021660) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SLC38A1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
44166156 3x 1.0 µg DNA

SLC38A1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details