Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3GL3 Rabbit pAb (APR25410N)

Product Specifications

Background

Implicated in endocytosis. May recruit other proteins to membranes with high curvature (By similarity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SH3GL3 Rabbit pAb (APR25410N) .

Synonyms

SH3GL3; CNSA3; EEN-B2; HsT19371; SH3D2C; SH3P13

Gene ID

6457

UniProt

Q99963

Cellular Locus

Cytoplasm, Early endosome membrane, Peripheral membrane protein

Dilution

WB 1:500 - 1:4000 IHC 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 31kDa/38kDa/39kDa/40kDa Observed MW: 39kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6457

Uniprot URL

https://www.uniprot.org/uniprot/Q99963

AA Sequence

MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMILIN1 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2513160 100 µL

EMILIN1 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
C15orf28 Protein Lysate (Human) with C-Ha Tag
13879031 100 µg

C15orf28 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
NPAP1 rabbit pAb
E44H12320 100 µL

NPAP1 rabbit pAb

Sign In for Pricing
View Details
ZC3H7A CRISPR/Cas9 KO Plasmid (h)
sc-412020 20 µg

ZC3H7A CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Peptidyl Prolyl Cis/Trans Isomerase NIMA Interacting Protein 1 (PIN1) Magnetic Luminex Assay Kit
LKU600776 96 Tests

Peptidyl Prolyl Cis/Trans Isomerase NIMA Interacting Protein 1 (PIN1) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Fam65a 3'UTR Luciferase Stable Cell Line
TU106297 1.0 mL

Fam65a 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details