Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAP2B Rabbit pAb (APR25400N)

Product Specifications

Background

This intronless gene belongs to a family of RAS-related genes. The proteins encoded by these genes share approximately 50% amino acid identity with the classical RAS proteins and have numerous structural features in common. The most striking difference between the RAP and RAS proteins resides in their 61st amino acid: glutamine in RAS is replaced by threonine in RAP proteins. Evidence suggests that this protein may be polyisoprenylated and palmitoylated.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RAP2B Rabbit pAb (APR25400N) .

Synonyms

RAP2B

Gene ID

5912

UniProt

P61225

Cellular Locus

Cytoplasmic side, Lipid-anchor, Recycling endosome membrane

Dilution

WB 1:100 - 1:500

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 20kDa Observed MW: 18kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5912

Uniprot URL

https://www.uniprot.org/uniprot/P61225

AA Sequence

MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat COX1 (Cytochrome C Oxidase Subunit I) ELISA Kit
MBS8821273-01 48 Well

Rat COX1 (Cytochrome C Oxidase Subunit I) ELISA Kit

Sign In for Pricing
View Details
Rat COX1 (Cytochrome C Oxidase Subunit I) ELISA Kit
MBS8821273-02 96 Well

Rat COX1 (Cytochrome C Oxidase Subunit I) ELISA Kit

Sign In for Pricing
View Details
Rat COX1 (Cytochrome C Oxidase Subunit I) ELISA Kit
MBS8821273-03 5x 96 Well

Rat COX1 (Cytochrome C Oxidase Subunit I) ELISA Kit

Sign In for Pricing
View Details
Rat COX1 (Cytochrome C Oxidase Subunit I) ELISA Kit
MBS8821273-04 10x 96 Well

Rat COX1 (Cytochrome C Oxidase Subunit I) ELISA Kit

Sign In for Pricing
View Details
C1orf198 Rabbit Polyclonal Antibody (BF488)
orb2510289 100 µL

C1orf198 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Rat Mammary Epithelial Cell Medium
ARM0295 500 mL

Rat Mammary Epithelial Cell Medium

Sign In for Pricing
View Details