Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFB2 Rabbit pAb (APR25372N)

Product Specifications

Background

The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I) . Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays a important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Hydropathy analysis revealed that this subunit and 4 other subunits have an overall hydrophilic pattern, even though they are found within the hydrophobic protein (HP) fraction of complex I.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NDUFB2 Rabbit pAb (APR25372N) .

Synonyms

NDUFB2; AGGG; CI-AGGG

Gene ID

4708

UniProt

O95178

Cellular Locus

Matrix side, Mitochondrion inner membrane, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa Observed MW: 12kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4708

Uniprot URL

https://www.uniprot.org/uniprot/O95178

AA Sequence

AGGGVHIEPRYRQFPQLTRSQVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLPTM1L sgRNA CRISPR Lentivector set (Human)
K0468201 3x 1.0 µg

CLPTM1L sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
CXorf57 Protein Lysate (Human) with C-Ha Tag
17210031 100 µg

CXorf57 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Recombinant Cation-efflux pump FieF (fieF)
orb2910462-01 20 µg

Recombinant Cation-efflux pump FieF (fieF)

Sign In for Pricing
View Details
Recombinant Cation-efflux pump FieF (fieF)
orb2910462-02 100 µg

Recombinant Cation-efflux pump FieF (fieF)

Sign In for Pricing
View Details
RGD1562758 3'UTR Luciferase Stable Cell Line
TU218643 1.0 mL

RGD1562758 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
VDR, ID (VDR, NR1I1, Vitamin D3 receptor, 1,25-dihydroxyvitamin D3 receptor, Nuclear receptor subfamily 1 group I member 1) (MaxLight 490) discontinued
043737-ML490 100 µL

VDR, ID (VDR, NR1I1, Vitamin D3 receptor, 1,25-dihydroxyvitamin D3 receptor, Nuclear receptor subfamily 1 group I member 1) (MaxLight 490) discontinued

Sign In for Pricing
View Details