Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFB2 Rabbit pAb (APR25372N)

Product Specifications

Background

The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I) . Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays a important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Hydropathy analysis revealed that this subunit and 4 other subunits have an overall hydrophilic pattern, even though they are found within the hydrophobic protein (HP) fraction of complex I.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NDUFB2 Rabbit pAb (APR25372N) .

Synonyms

NDUFB2; AGGG; CI-AGGG

Gene ID

4708

UniProt

O95178

Cellular Locus

Matrix side, Mitochondrion inner membrane, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa Observed MW: 12kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4708

Uniprot URL

https://www.uniprot.org/uniprot/O95178

AA Sequence

AGGGVHIEPRYRQFPQLTRSQVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARSE Antibody
A24255-50UG 50 µg

ARSE Antibody

Sign In for Pricing
View Details
NT-3 (Neurotrophin 3, Neurotrophin-3, NT3, NTF3, HDNF, MGC129711, Nerve Growth Factor 2, Nerve Growth Factor-2, NGF2, NGF-2, Neurotrophic Factor) (MaxLight 650)
130587-ML650 100 µL

NT-3 (Neurotrophin 3, Neurotrophin-3, NT3, NTF3, HDNF, MGC129711, Nerve Growth Factor 2, Nerve Growth Factor-2, NGF2, NGF-2, Neurotrophic Factor) (MaxLight 650)

Sign In for Pricing
View Details
ATP5A (51) : m-IgG Fc BP-HRP Bundle
sc-539899 1 Kit

ATP5A (51) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Heregulin-1 / Neuregulin-1 (Breast and Urothelial Marker) (NRG1/2710), CF488A conjugate, 0.1mg/mL
BNC882710-500 1x 500 µL

Heregulin-1 / Neuregulin-1 (Breast and Urothelial Marker) (NRG1/2710), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Onecut1 Pre-designed siRNA Set B
SI109822B 1 Each

Mouse Onecut1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
LDLRAP1 Antibody
A57767-100UL 100 µL

LDLRAP1 Antibody

Sign In for Pricing
View Details