Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT81 Rabbit pAb (APR25361N)

Product Specifications

Background

The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity. One subfamily, consisting of KRTHB1, KRTHB3, and KRTHB6, is highly related. The other less-related subfamily includes KRTHB2, KRTHB4, and KRTHB5. All hair keratins are expressed in the hair follicle; this hair keratin, as well as KRTHB3 and KRTHB6, is found primarily in the hair cortex. Mutations in this gene and KRTHB6 have been observed in patients with a rare dominant hair disease, monilethrix.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KRT81 Rabbit pAb (APR25361N) .

Synonyms

KRT81; HB1; Hb-1; KRTHB1; MLN137; ghHkb1; hHAKB2-1

Gene ID

3887

UniProt

Q14533

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 54kDa Observed MW: 55KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3887

Uniprot URL

https://www.uniprot.org/uniprot/Q14533

AA Sequence

RRLYEEEILILQSHISDTSVVVKLDNSRDLNMDCIIAEIKAQYDDIVTRSRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAVAQSEQQGEAALSDARCKLAELEGALQKAKQDMACLIREYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P2Y1 Polyclonal Antibody FITC Conjugated
MBS9463337-01 0.1 mL

P2Y1 Polyclonal Antibody FITC Conjugated

Sign In for Pricing
View Details
P2Y1 Polyclonal Antibody FITC Conjugated
MBS9463337-02 5x 0.1 mL

P2Y1 Polyclonal Antibody FITC Conjugated

Sign In for Pricing
View Details
2- (4-Chlorophenyl) thiophen-3-amine hydrochloride
TCC07364-01 50 mg

2- (4-Chlorophenyl) thiophen-3-amine hydrochloride

Sign In for Pricing
View Details
2- (4-Chlorophenyl) thiophen-3-amine hydrochloride
TCC07364-02 0.5 g

2- (4-Chlorophenyl) thiophen-3-amine hydrochloride

Sign In for Pricing
View Details
GSC (Homeobox Protein Goosecoid) (MaxLight 405)
MBS6190435-01 0.1 mL

GSC (Homeobox Protein Goosecoid) (MaxLight 405)

Sign In for Pricing
View Details
GSC (Homeobox Protein Goosecoid) (MaxLight 405)
MBS6190435-02 5x 0.1 mL

GSC (Homeobox Protein Goosecoid) (MaxLight 405)

Sign In for Pricing
View Details