Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFIT3 Rabbit pAb (APR25357N)

Product Specifications

Background

IFN-induced antiviral protein which acts as an inhibitor of cellular as well as viral processes, cell migration, proliferation, signaling, and viral replication. Enhances MAVS-mediated host antiviral responses by serving as an adapter bridging TBK1 to MAVS which leads to the activation of TBK1 and phosphorylation of IRF3 and phosphorylated IRF3 translocates into nucleus to promote antiviral gene transcription. Exhibits an antiproliferative activity via the up-regulation of cell cycle negative regulators CDKN1A/p21 and CDKN1B/p27. Normally, CDKN1B/p27 turnover is regulated by COPS5, which binds CDKN1B/p27 in the nucleus and exports it to the cytoplasm for ubiquitin-dependent degradation. IFIT3 sequesters COPS5 in the cytoplasm, thereby increasing nuclear CDKN1B/p27 protein levels. Upregulates CDKN1A/p21 by downregulating MYC, a repressor of CDKN1A/p21. Can negatively regulate the apoptotic effects of IFIT2.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IFIT3 Rabbit pAb (APR25357N) .

Synonyms

IFIT3; CIG-49; GARG-49; IFI60; IFIT4; IRG2; ISG60; P60; RIG-G; cig41

Gene ID

15959

UniProt

O14879

Cellular Locus

Cytoplasm, Mitochondrion

Applications

IHC (Rattus norvegicus) WB (Mus musculus)

Dilution

WB 1:500 - 1:1000 IHC 1:100 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 47kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=15959

Uniprot URL

https://www.uniprot.org/uniprot/O14879

AA Sequence

ANPYSMECPELECEEGWTRLKCGRNERAKMCFEKALEEKPKDPECSSGMAIAMFRLEEKPEKQFSVDALKQAMELNPQNQYLKVLLALKLLRMGEEAEGERLIKDALGKAPNQTDVLQKAAQFYKKKGNLDRAIELLGKALRSTVNNSPLYSLVMCRYREILEQLQNKGDADSSERRQRMAELRRLTMEFMQKTLQRRRSPLNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BPIFC activation kit by CRISPRa
GA116778 1 Kit

Human BPIFC activation kit by CRISPRa

Sign In for Pricing
View Details
FACL4 (ACSL4) (NM_004458) Human Over-expression Lysate
LY401417 100 µg

FACL4 (ACSL4) (NM_004458) Human Over-expression Lysate

Sign In for Pricing
View Details
2-(1-Aminocyclohexyl)acetic Acid
TRC-A619890-500MG 500 mg

2-(1-Aminocyclohexyl)acetic Acid

Sign In for Pricing
View Details
Tissue FFPE Sections, Cartilage
CS806016 5x 5 µm

Tissue FFPE Sections, Cartilage

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/2497R), CF405S conjugate, 0.1mg/mL
BNC042497-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/2497R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bulk Human IgG4 (IB4) Isotype Control S228P
ICH2257S228P-5mg 5 mg

Bulk Human IgG4 (IB4) Isotype Control S228P

Sign In for Pricing
View Details