Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNC1I1 Rabbit pAb (APR25330N)

Product Specifications

Background

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. The intermediate chains mediate the binding of dynein to dynactin via its 150 kDa component (p150-glued DCTN1. May play a role in mediating the interaction of cytoplasmic dynein with membranous organelles and kinetochores.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DYNC1I1 Rabbit pAb (APR25330N) .

Synonyms

DYNC1I1; DNCI1; DNCIC1

Gene ID

1780

UniProt

O14576

Cellular Locus

Chromosome, Cytoplasm, centromere, cytoskeleton, kinetochore, spindle pole

Dilution

WB 1:200 - 1:2000 IHC 1:20 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 67kDa/68kDa/70kDa/72kDa Observed MW: 73kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1780

Uniprot URL

https://www.uniprot.org/uniprot/O14576

AA Sequence

MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISPEPPLVPTPMSPSSKSVSTPSEAGSQDSGDLGPLTRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEEMVESKVGQDSELENQDKKQEVKEAPPRELTEEEKQQILHSEEFLIFFDRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENDOGL1 / ENGL Rabbit mAb [KD Validated] Antibody
orb1950394-01 50 µL

ENDOGL1 / ENGL Rabbit mAb [KD Validated] Antibody

Sign In for Pricing
View Details
ENDOGL1 / ENGL Rabbit mAb [KD Validated] Antibody
orb1950394-02 100 µL

ENDOGL1 / ENGL Rabbit mAb [KD Validated] Antibody

Sign In for Pricing
View Details
PRSS1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
37830064 1.0 µg DNA

PRSS1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Mouse IL36α / Interleukin-36 alpha, Animal Free & Carrier Free
C-CYP187-100ug 100 µg

Recombinant Mouse IL36α / Interleukin-36 alpha, Animal Free & Carrier Free

Sign In for Pricing
View Details
Dulbecco’s MEM (DMEM) High Glucose, w/ L-Glutamine, Pyridoxal•HCl w/o Folic Acid, Methionine (Liquid)
D9803-01A-L 500 mL

Dulbecco’s MEM (DMEM) High Glucose, w/ L-Glutamine, Pyridoxal•HCl w/o Folic Acid, Methionine (Liquid)

Sign In for Pricing
View Details
Phospho-Cdc25B (Ser323) Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-5243R-BF594 100 µL

Phospho-Cdc25B (Ser323) Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details