Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNC1I1 Rabbit pAb (APR25330N)

Product Specifications

Background

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. The intermediate chains mediate the binding of dynein to dynactin via its 150 kDa component (p150-glued DCTN1. May play a role in mediating the interaction of cytoplasmic dynein with membranous organelles and kinetochores.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DYNC1I1 Rabbit pAb (APR25330N) .

Synonyms

DYNC1I1; DNCI1; DNCIC1

Gene ID

1780

UniProt

O14576

Cellular Locus

Chromosome, Cytoplasm, centromere, cytoskeleton, kinetochore, spindle pole

Dilution

WB 1:200 - 1:2000 IHC 1:20 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 67kDa/68kDa/70kDa/72kDa Observed MW: 73kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1780

Uniprot URL

https://www.uniprot.org/uniprot/O14576

AA Sequence

MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISPEPPLVPTPMSPSSKSVSTPSEAGSQDSGDLGPLTRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEEMVESKVGQDSELENQDKKQEVKEAPPRELTEEEKQQILHSEEFLIFFDRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCP3 (CCL7) Mouse Monoclonal Antibody [Clone ID: 113]
DM2035 500 µg

MCP3 (CCL7) Mouse Monoclonal Antibody [Clone ID: 113]

Sign In for Pricing
View Details
CYP7A1 Antibody - middle region
MBS3220754-01 0.1 mL

CYP7A1 Antibody - middle region

Sign In for Pricing
View Details
CYP7A1 Antibody - middle region
MBS3220754-02 5x 0.1 mL

CYP7A1 Antibody - middle region

Sign In for Pricing
View Details
mmu-miR-467e miRNA Antagomir
MNM02142 2x 5.0 nmol

mmu-miR-467e miRNA Antagomir

Sign In for Pricing
View Details
PDSS2 Rabbit Polyclonal Antibody (BF350)
orb2558598 100 µL

PDSS2 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Recombinant Ustilago maydis Serine/threonine-protein phosphatase 2A activator 1 (RRD1)
MBS1409952-01 0.02 mg (E-Coli)

Recombinant Ustilago maydis Serine/threonine-protein phosphatase 2A activator 1 (RRD1)

Sign In for Pricing
View Details