Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX6A1 Rabbit pAb (APR25317N)

Product Specifications

Background

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in the electron transfer and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (liver isoform) of subunit VIa, and polypeptide 1 is found in all non-muscle tissues. Polypeptide 2 (heart/muscle isoform) of subunit VIa is encoded by a different gene, and is present only in striated muscles. These two polypeptides share 66% amino acid sequence identity. It has been reported that there may be several pseudogenes on chromosomes 1, 6, 7q21, 7q31-32 and 12. However, only one pseudogene (COX6A1P) on chromosome 1p31.1 has been documented.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality COX6A1 Rabbit pAb (APR25317N) .

Synonyms

COX6A1; CMTRID; COX6A; COX6AL

Gene ID

1337

UniProt

P12074

Cellular Locus

Mitochondrion inner membrane

Dilution

WB 1:200 - 1:2000 IHC 1:20 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa Observed MW: 12kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1337

Uniprot URL

https://www.uniprot.org/uniprot/P12074

AA Sequence

SSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THSD1 Antibody (Biotin)
KB-23229-01 50 μL

THSD1 Antibody (Biotin)

Sign In for Pricing
View Details
THSD1 Antibody (Biotin)
KB-23229-02 100 µL

THSD1 Antibody (Biotin)

Sign In for Pricing
View Details
THSD1 Antibody (Biotin)
KB-23229-03 1 mL

THSD1 Antibody (Biotin)

Sign In for Pricing
View Details
Gng10 (NM_025277) Mouse Tagged ORF Clone
MG200063 10 µg

Gng10 (NM_025277) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
IL-1 alpha Antibody
KC-828-01 50 μL

IL-1 alpha Antibody

Sign In for Pricing
View Details
IL-1 alpha Antibody
KC-828-02 100 µL

IL-1 alpha Antibody

Sign In for Pricing
View Details