Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARF5 Rabbit pAb (APR25295N)

Product Specifications

Background

This gene is a member of the human ADP-ribosylation factor (ARF) gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2, and ARF3), class II (ARF4 and ARF5) and class III (ARF6) . The members of each class share a common gene organization.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ARF5 Rabbit pAb (APR25295N) .

Synonyms

ARF5

Gene ID

381

UniProt

P84085

Cellular Locus

Cytoplasm, Golgi apparatus, Lipid-anchor, Membrane, perinuclear region

Dilution

WB 1:1000 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 20kDa Observed MW: 16kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=381

Uniprot URL

https://www.uniprot.org/uniprot/P84085

AA Sequence

MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mitochondria Isolation Kit for Tissue and Cultured Cells
KC010100 1 Kit

Mitochondria Isolation Kit for Tissue and Cultured Cells

Sign In for Pricing
View Details
Mouse CBX7 shRNA Plasmid
abx974259-01 150 µg

Mouse CBX7 shRNA Plasmid

Sign In for Pricing
View Details
Mouse CBX7 shRNA Plasmid
abx974259-02 300 µg

Mouse CBX7 shRNA Plasmid

Sign In for Pricing
View Details
Recombinant Mycobacterium Avium mshC Protein (aa 1-384)
VAng-Yyj2666-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Avium mshC Protein (aa 1-384)

Sign In for Pricing
View Details
Recombinant Rhesus Macaque OS9 Protein, His (Fc)-Avi-tagged
OS9-3067R 50 µg

Recombinant Rhesus Macaque OS9 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Diphenmanil methylsulfate 10mg
A16513-10 10 mg

Diphenmanil methylsulfate 10mg

Sign In for Pricing
View Details