Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB8B Rabbit pAb (APR25286N)

Product Specifications

Background

RAB proteins, like RAB8B, are low molecular mass monomeric GTPases that localize on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB proteins function in intracellular vesicle transport by aiding in the docking and/or fusion of vesicles with their target membranes (summary by Chen et al., 1997 [PubMed 9030196]) .[supplied by OMIM, Nov 2010]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RAB8B Rabbit pAb (APR25286N) .

Synonyms

RAB8B

Gene ID

51762

UniProt

Q92930

Cellular Locus

Cell membrane, Cytoplasmic side, Cytoplasmic vesicle, Lipid-anchor, phagosome, phagosome membrane

Dilution

WB 1:500 - 1:1000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 23kDa Observed MW: 23KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51762

Uniprot URL

https://www.uniprot.org/uniprot/Q92930

AA Sequence

MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-JAK2 (Tyr1007+Tyr1008) Recombinant Antibody, Biotin Conjugated
bsm-52171R-Biotin-TR 20 µL

Phospho-JAK2 (Tyr1007+Tyr1008) Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
PPP1R16B (NM_015568) Human Tagged ORF Clone
RC218476 10 µg

PPP1R16B (NM_015568) Human Tagged ORF Clone

Sign In for Pricing
View Details
Uricase Polyclonal Antibody, Cy7 Conjugated
bs-6716R-Cy7-01 20 µL

Uricase Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Uricase Polyclonal Antibody, Cy7 Conjugated
bs-6716R-Cy7-02 100 µL

Uricase Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Mouse Top1 (NM_009408) AAV Particle
MR218547A1V 250 µL

Mouse Top1 (NM_009408) AAV Particle

Sign In for Pricing
View Details
Ribonuclease 7 (RNASE7) CytoSection
TS417325P5 25 Slides

Ribonuclease 7 (RNASE7) CytoSection

Sign In for Pricing
View Details