Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCT6A Rabbit pAb (APR25265N)

Product Specifications

Background

The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC) . This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, several pseudogenes of this gene have been located.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CCT6A Rabbit pAb (APR25265N) .

Synonyms

CCT6A; CCT-zeta; CCT-zeta-1; CCT6; Cctz; HTR3; MoDP-2; TCP-1-zeta; TCP20; TCPZ; TTCP20

Gene ID

908

UniProt

P40227

Cellular Locus

Cytoplasm

Applications

WB (Rattus norvegicus) IHC (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 53kDa/58kDa Observed MW: 58KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=908

Uniprot URL

https://www.uniprot.org/uniprot/P40227

AA Sequence

VATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGFEAAKEKALQFLEEVKVSREMDRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIKKQDEPIDLFMIEIMEMKHKSETDTSLIRGLVLDHGARHPDMKKRVEDAYILTCNVSLEYEKTEVNSGFFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CYSRT1 qPCR Primer Pair
QH74801S 200 Tests

Human CYSRT1 qPCR Primer Pair

Sign In for Pricing
View Details
β-defensin 5 HDR Plasmid (h)
sc-416488-HDR 20 µg

β-defensin 5 HDR Plasmid (h)

Sign In for Pricing
View Details
Recombinant Haloferax volcanii Small archaeal modifier protein 1 (HVO_2619)
MBS1180296-01 0.05 mg (E-Coli)

Recombinant Haloferax volcanii Small archaeal modifier protein 1 (HVO_2619)

Sign In for Pricing
View Details
Recombinant Haloferax volcanii Small archaeal modifier protein 1 (HVO_2619)
MBS1180296-02 0.2 mg (E-Coli)

Recombinant Haloferax volcanii Small archaeal modifier protein 1 (HVO_2619)

Sign In for Pricing
View Details
Recombinant Haloferax volcanii Small archaeal modifier protein 1 (HVO_2619)
MBS1180296-03 0.05 mg (Yeast)

Recombinant Haloferax volcanii Small archaeal modifier protein 1 (HVO_2619)

Sign In for Pricing
View Details
Recombinant Haloferax volcanii Small archaeal modifier protein 1 (HVO_2619)
MBS1180296-04 0.5 mg (E-Coli)

Recombinant Haloferax volcanii Small archaeal modifier protein 1 (HVO_2619)

Sign In for Pricing
View Details