Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VNN1 Rabbit pAb (APR25217N)

Product Specifications

Background

This gene encodes a member of the vanin family of proteins, which share extensive sequence similarity with each other, and also with biotinidase. The family includes secreted and membrane-associated proteins, a few of which have been reported to participate in hematopoietic cell trafficking. No biotinidase activity has been demonstrated for any of the vanin proteins, however, they possess pantetheinase activity, which may play a role in oxidative-stress response. This protein, like its mouse homolog, is likely a GPI-anchored cell surface molecule. The mouse protein is expressed by the perivascular thymic stromal cells and regulates migration of T-cell progenitors to the thymus. This gene lies in close proximity to, and in the same transcriptional orientation as, two other vanin genes on chromosome 6q23-q24.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality VNN1 Rabbit pAb (APR25217N) .

Synonyms

VNN1; HDLCQ8; Tiff66; vanin 1

Gene ID

8876

UniProt

O95497

Cellular Locus

Cell membrane, GPI-anchor, Lipid-anchor

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 57kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8876

Uniprot URL

https://www.uniprot.org/uniprot/O95497

AA Sequence

LLSQLDSHPSHSAVVNWTSYASSIEALSSGNKEFKGTVFFDEFTFVKLTGVAGNYTVCQKDLCCHLSYKMSENIPNEVYALGAFDGLHTVEGRYYLQICTLLKCKTTNLNTCGDSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to S100 Calcium Binding Protein A4 (S100A4)
MBS2126731-01 0.1 mL

Polyclonal Antibody to S100 Calcium Binding Protein A4 (S100A4)

Sign In for Pricing
View Details
Polyclonal Antibody to S100 Calcium Binding Protein A4 (S100A4)
MBS2126731-02 0.2 mL

Polyclonal Antibody to S100 Calcium Binding Protein A4 (S100A4)

Sign In for Pricing
View Details
Polyclonal Antibody to S100 Calcium Binding Protein A4 (S100A4)
MBS2126731-03 0.5 mL

Polyclonal Antibody to S100 Calcium Binding Protein A4 (S100A4)

Sign In for Pricing
View Details
Polyclonal Antibody to S100 Calcium Binding Protein A4 (S100A4)
MBS2126731-04 1 mL

Polyclonal Antibody to S100 Calcium Binding Protein A4 (S100A4)

Sign In for Pricing
View Details
Polyclonal Antibody to S100 Calcium Binding Protein A4 (S100A4)
MBS2126731-05 5 mL

Polyclonal Antibody to S100 Calcium Binding Protein A4 (S100A4)

Sign In for Pricing
View Details
Polyclonal Antibody to S100 Calcium Binding Protein A4 (S100A4)
MBS2126731-06 5x 5 mL

Polyclonal Antibody to S100 Calcium Binding Protein A4 (S100A4)

Sign In for Pricing
View Details