Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF5A Rabbit pAb (APR25202N)

Product Specifications

Background

This gene encodes a member of the kinesin family of proteins. Members of this family are part of a multisubunit complex that functions as a microtubule motor in intracellular organelle transport. Mutations in this gene cause autosomal dominant spastic paraplegia 10.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KIF5A Rabbit pAb (APR25202N) .

Synonyms

KIF5A; D12S1889; MY050; NEIMY; NKHC; SPG10

Gene ID

3798

UniProt

Q12840

Cellular Locus

Cytoplasm, cytoskeleton, perinuclear region

Applications

IF (Mus musculus)

Dilution

WB 1:1000 - 1:3000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 117kDa Observed MW: 129kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3798

Uniprot URL

https://www.uniprot.org/uniprot/Q12840

AA Sequence

TNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQETAAS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IL-28B/IFN-lambda 3 MAb (Clone 244710)
MAB1789-SP 25 µg

Mouse IL-28B/IFN-lambda 3 MAb (Clone 244710)

Sign In for Pricing
View Details
COX7A1, ID (COX7A1, COX7AH, Cytochrome c oxidase subunit 7A1, mitochondrial, Cytochrome c oxidase subunit VIIa-heart, Cytochrome c oxidase subunit VIIa-muscle) (PE)
MBS6288152-01 0.2 mL

COX7A1, ID (COX7A1, COX7AH, Cytochrome c oxidase subunit 7A1, mitochondrial, Cytochrome c oxidase subunit VIIa-heart, Cytochrome c oxidase subunit VIIa-muscle) (PE)

Sign In for Pricing
View Details
COX7A1, ID (COX7A1, COX7AH, Cytochrome c oxidase subunit 7A1, mitochondrial, Cytochrome c oxidase subunit VIIa-heart, Cytochrome c oxidase subunit VIIa-muscle) (PE)
MBS6288152-02 5x 0.2 mL

COX7A1, ID (COX7A1, COX7AH, Cytochrome c oxidase subunit 7A1, mitochondrial, Cytochrome c oxidase subunit VIIa-heart, Cytochrome c oxidase subunit VIIa-muscle) (PE)

Sign In for Pricing
View Details
Lentiviral human PLAA sgRNA gene knockout kit - Lentiviral human PLAA sgRNA gene knockout kit (100)
GTR15356161 1 Vial

Lentiviral human PLAA sgRNA gene knockout kit - Lentiviral human PLAA sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Olfr898 Mouse shRNA Plasmid (Locus ID 258871)
TR507928 1 Kit

Olfr898 Mouse shRNA Plasmid (Locus ID 258871)

Sign In for Pricing
View Details
Cd52 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6953904 1.0 µg DNA

Cd52 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details