Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] GSK3β Rabbit pAb (APR25153N)

Product Specifications

Background

The protein encoded by this gene is a serine-threonine kinase, belonging to the glycogen synthase kinase subfamily. It is involved in energy metabolism, neuronal cell development, and body pattern formation. Polymorphisms in this gene have been implicated in modifying risk of Parkinson disease, and studies in mice show that overexpression of this gene may be relevant to the pathogenesis of Alzheimer disease. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] GSK3β Rabbit pAb (APR25153N) .

Synonyms

GSK3B; gsk-3β

Gene ID

2932

UniProt

P49841

Cellular Locus

Cell membrane, Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:1000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 46kDa/48kDa Observed MW: 46kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2932

Uniprot URL

https://www.uniprot.org/uniprot/P49841

AA Sequence

PWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBD1 Monoclonal Antibody, PE-Cy5 Conjugated
bsm-63074R-PE-Cy5 100 µL

MBD1 Monoclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
MLF1 Antibody
MBS851990-01 0.1 mg

MLF1 Antibody

Sign In for Pricing
View Details
MLF1 Antibody
MBS851990-02 0.1 mL (AF635)

MLF1 Antibody

Sign In for Pricing
View Details
MLF1 Antibody
MBS851990-03 0.1 mL (AF610)

MLF1 Antibody

Sign In for Pricing
View Details
MLF1 Antibody
MBS851990-04 0.1 mL (AF405S)

MLF1 Antibody

Sign In for Pricing
View Details
MLF1 Antibody
MBS851990-05 0.1 mL (AF405L)

MLF1 Antibody

Sign In for Pricing
View Details