Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSTR2 Rabbit pAb (APR25140N)

Product Specifications

Background

Somatostatin acts at many sites to inhibit the release of many hormones and other secretory proteins. The biologic effects of somatostatin are probably mediated by a family of G protein-coupled receptors that are expressed in a tissue-specific manner. SSTR2 is a member of the superfamily of receptors having seven transmembrane segments and is expressed in highest levels in cerebrum and kidney.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SSTR2 Rabbit pAb (APR25140N) .

Synonyms

SSTR2; somatostatin receptor 2; SS 2 R; SS2R; SRIF 1; SS2 R; SRIF-1

Gene ID

6752

UniProt

P30874

Cellular Locus

Cell membrane, Cytoplasm, Multi-pass membrane protein

Dilution

WB 1:500 - 1:1000 IHC 1:50 - 1:100 IF 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 40kDa/41kDa Observed MW: 87KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6752

Uniprot URL

https://www.uniprot.org/uniprot/P30874

AA Sequence

LTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B3gnt5 Mouse Gene Knockout Kit (CRISPR)
KN501924 1 Kit

B3gnt5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Glucokinase (GCK) Mouse Monoclonal Antibody [Clone ID: 4G6]
AM06654SU-N 100 µL

Glucokinase (GCK) Mouse Monoclonal Antibody [Clone ID: 4G6]

Sign In for Pricing
View Details
Acid Blue 9 (Technical Grade)
TRC-A189815-50MG 50 mg

Acid Blue 9 (Technical Grade)

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS509733 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
TNRC18 Antibody
KC-19705-01 50 μL

TNRC18 Antibody

Sign In for Pricing
View Details
TNRC18 Antibody
KC-19705-02 100 µL

TNRC18 Antibody

Sign In for Pricing
View Details