Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSTR2 Rabbit pAb (APR25140N)

Product Specifications

Background

Somatostatin acts at many sites to inhibit the release of many hormones and other secretory proteins. The biologic effects of somatostatin are probably mediated by a family of G protein-coupled receptors that are expressed in a tissue-specific manner. SSTR2 is a member of the superfamily of receptors having seven transmembrane segments and is expressed in highest levels in cerebrum and kidney.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SSTR2 Rabbit pAb (APR25140N) .

Synonyms

SSTR2; somatostatin receptor 2; SS 2 R; SS2R; SRIF 1; SS2 R; SRIF-1

Gene ID

6752

UniProt

P30874

Cellular Locus

Cell membrane, Cytoplasm, Multi-pass membrane protein

Dilution

WB 1:500 - 1:1000 IHC 1:50 - 1:100 IF 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 40kDa/41kDa Observed MW: 87KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6752

Uniprot URL

https://www.uniprot.org/uniprot/P30874

AA Sequence

LTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPK4 (C-term) Rabbit Polyclonal Antibody
AP14040PU-N 400 µL

MAPK4 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SPANX (SPANXC) Rabbit Polyclonal Antibody
AP07638PU-N 50 µg

SPANX (SPANXC) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tridehydro Pirlimycin-d5
TRC-T775302-1MG 1 mg

Tridehydro Pirlimycin-d5

Sign In for Pricing
View Details
ROR gamma (RORC) Mouse Monoclonal Antibody [Clone ID: OTI1G3]
CF809592 100 µg

ROR gamma (RORC) Mouse Monoclonal Antibody [Clone ID: OTI1G3]

Sign In for Pricing
View Details
Cytokeratin 13 Recombinant Rabbit monoclonal Antibody
HA750261 100 µL

Cytokeratin 13 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Freeze Dryer BFFT-203-A
BFFT-203-A 1 Unit

Freeze Dryer BFFT-203-A

Sign In for Pricing
View Details