Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PP2A Catalytic β Rabbit pAb (APR25134N)

Product Specifications

Background

This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes a beta isoform of the catalytic subunit.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PP2A Catalytic β Rabbit pAb (APR25134N) .

Synonyms

PPP2CB; PP2Abeta; PP2CB

Gene ID

5516

UniProt

P62714

Cellular Locus

Chromosome, Cytoplasm, Nucleus, centromere, cytoskeleton, spindle pole

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 35kDa Observed MW: 36KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5516

Uniprot URL

https://www.uniprot.org/uniprot/P62714

AA Sequence

MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2900064A13Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4103706 1.0 µg DNA

2900064A13Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
RMDN3 Polyclonal Antibody, Biotin Conjugated
A56518-050 50 µL

RMDN3 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
IL1R1 3'UTR GFP Stable Cell Line
TU061024 1.0 mL

IL1R1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PKA R2 (PRKAR2A) Human siRNA Oligo Duplex (Locus ID 5576)
SR303733 1 Kit

PKA R2 (PRKAR2A) Human siRNA Oligo Duplex (Locus ID 5576)

Sign In for Pricing
View Details
[KO Validated] AMPKβ1 Rabbit pAb (APR19120N)
APR19120N-01 50 µL

[KO Validated] AMPKβ1 Rabbit pAb (APR19120N)

Sign In for Pricing
View Details
[KO Validated] AMPKβ1 Rabbit pAb (APR19120N)
APR19120N-02 100 µL

[KO Validated] AMPKβ1 Rabbit pAb (APR19120N)

Sign In for Pricing
View Details