Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rad52 Rabbit pAb (APR25109N)

Product Specifications

Background

The protein encoded by this gene shares similarity with Saccharomyces cerevisiae Rad52, a protein important for DNA double-strand break repair and homologous recombination. This gene product was shown to bind single-stranded DNA ends, and mediate the DNA-DNA interaction necessary for the annealing of complementary DNA strands. It was also found to interact with DNA recombination protein RAD51, which suggested its role in RAD51 related DNA recombination and repair. A pseudogene of this gene is present on chromosome 2. Alternative splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Rad52 Rabbit pAb (APR25109N) .

Synonyms

RAD52

Gene ID

5893

UniProt

P43351

Cellular Locus

Nucleus

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:1000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa/15kDa/24kDa/46kDa Observed MW: 50KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5893

Uniprot URL

https://www.uniprot.org/uniprot/P43351

AA Sequence

GYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRPNMALGHPQLQQVTSPSRPSHAVIPADQDCSSRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHSTPVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ATF4 (Activating Transcription Factor 4, ATF 4, ATF4 Protein, cAMP-Dependent Transcription Factor ATF-4, cAMP-Responsive Element-Binding Protein 2, CREB 2, CREB-2, CREB2, Cyclic AMP Dependent Transcription Factor ATF 4, Cyclic AMP Response Element Binding Protein 2, Cyclic AMP Response Element Binding Protein 2, Cyclic AMP-Dependent Transcription Factor ATF-4, Cyclic AMP-Responsive Element-Binding Protein 2, DNA Binding Protein TAXREB67, DNA Binding Protein TAXREB67, DNA-Binding Protein TAXREB67, Tax Responsive Enhancer Element B67, Tax-Responsive Enhancer Element-Binding Protein 67, TAXREB67, TXREB)
384901 100 µg

ATF4 (Activating Transcription Factor 4, ATF 4, ATF4 Protein, cAMP-Dependent Transcription Factor ATF-4, cAMP-Responsive Element-Binding Protein 2, CREB 2, CREB-2, CREB2, Cyclic AMP Dependent Transcription Factor ATF 4, Cyclic AMP Response Element Binding Protein 2, Cyclic AMP Response Element Binding Protein 2, Cyclic AMP-Dependent Transcription Factor ATF-4, Cyclic AMP-Responsive Element-Binding Protein 2, DNA Binding Protein TAXREB67, DNA Binding Protein TAXREB67, DNA-Binding Protein TAXREB67, Tax Responsive Enhancer Element B67, Tax-Responsive Enhancer Element-Binding Protein 67, TAXREB67, TXREB)

Ask
View Details
Lentiviral human JOSD2 shRNA (UAS) - Lentiviral human JOSD2 shRNA (UAS, RFP) plasmid
GTR15310468 1 Vial

Lentiviral human JOSD2 shRNA (UAS) - Lentiviral human JOSD2 shRNA (UAS, RFP) plasmid

Ask
View Details
Recombinant Tropidechis carinatus Short neurotoxin 2
MBS1051735-01 0.02 mg (E-Coli)

Recombinant Tropidechis carinatus Short neurotoxin 2

Ask
View Details
Recombinant Tropidechis carinatus Short neurotoxin 2
MBS1051735-02 0.1 mg (E-Coli)

Recombinant Tropidechis carinatus Short neurotoxin 2

Ask
View Details
Recombinant Tropidechis carinatus Short neurotoxin 2
MBS1051735-03 0.02 mg (Yeast)

Recombinant Tropidechis carinatus Short neurotoxin 2

Ask
View Details
Recombinant Tropidechis carinatus Short neurotoxin 2
MBS1051735-04 0.1 mg (Yeast)

Recombinant Tropidechis carinatus Short neurotoxin 2

Ask
View Details