Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA10 Rabbit pAb (APR25087N)

Product Specifications

Background

Ionotropic receptor with a probable role in the modulation of auditory stimuli. Agonist binding may induce an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The channel is permeable to a range of divalent cations including calcium, the influx of which may activate a potassium current which hyperpolarizes the cell membrane. In the ear, this may lead to a reduction in basilar membrane motion, altering the activity of auditory nerve fibers and reducing the range of dynamic hearing. This may protect against acoustic trauma.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CHRNA10 Rabbit pAb (APR25087N) .

Synonyms

CHRNA10

Gene ID

57053

UniProt

Q9GZZ6

Cellular Locus

Cell junction, Cell membrane, Multi-pass membrane protein, postsynaptic cell membrane, synapse

Dilution

WB 1:200 - 1:1000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 49kDa Observed MW: 45kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=57053

Uniprot URL

https://www.uniprot.org/uniprot/Q9GZZ6

AA Sequence

AEGRLALKLFRDLFANYTSALRPVADTDQTLNVTLEVTLSQIIDMDERNQVLTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYNKADAQPPGSASTNVVLRHDGAVRWDAPAITRSSCRVDVAAFPFDAQHCGLTFGSWTHGGHQLDVRPRGAAASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYV

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

rac 1-Linolenoyl-3-chloropropanediol-d5
TRC-L467702-2.5MG 2.5 mg

rac 1-Linolenoyl-3-chloropropanediol-d5

Ask
View Details
NKX2-6, NT (NKX2-6, NKX2F, Homeobox protein Nkx-2.6, Homeobox protein NK-2 homolog F) (APC)
MBS6325588-01 0.2 mL

NKX2-6, NT (NKX2-6, NKX2F, Homeobox protein Nkx-2.6, Homeobox protein NK-2 homolog F) (APC)

Ask
View Details
NKX2-6, NT (NKX2-6, NKX2F, Homeobox protein Nkx-2.6, Homeobox protein NK-2 homolog F) (APC)
MBS6325588-02 5x 0.2 mL

NKX2-6, NT (NKX2-6, NKX2F, Homeobox protein Nkx-2.6, Homeobox protein NK-2 homolog F) (APC)

Ask
View Details
Mouse Gpx4 Pre-designed siRNA Set B
SI105823B 1 Each

Mouse Gpx4 Pre-designed siRNA Set B

Ask
View Details
Rabbit Anti Human GSK3 beta Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH 7.4)(Western Blot, IHC-p, Immunofluorescence, ELISA)
MBS8423946-01 0.12 mL

Rabbit Anti Human GSK3 beta Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH 7.4)(Western Blot, IHC-p, Immunofluorescence, ELISA)

Ask
View Details
Rabbit Anti Human GSK3 beta Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH 7.4)(Western Blot, IHC-p, Immunofluorescence, ELISA)
MBS8423946-02 5x 0.12 mL

Rabbit Anti Human GSK3 beta Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH 7.4)(Western Blot, IHC-p, Immunofluorescence, ELISA)

Ask
View Details