Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLK2 Rabbit pAb (APR25060N)

Product Specifications

Background

This gene encodes a member of the grandular kallikrein protein family. Kallikreins are a subgroup of serine proteases that are clustered on chromosome 19. Members of this family are involved in a diverse array of biological functions. The protein encoded by this gene is a highly active trypsin-like serine protease that selectively cleaves at arginine residues. This protein is primarily expressed in prostatic tissue and is responsible for cleaving pro-prostate-specific antigen into its enzymatically active form. This gene is highly expressed in prostate tumor cells and may be a prognostic maker for prostate cancer risk. Alternate splicing results in both coding and non-coding transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KLK2 Rabbit pAb (APR25060N) .

Synonyms

KLK2; KLK2A2; hGK-1; hK2

Gene ID

3817

UniProt

P20151

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa/18kDa/24kDa/28kDa Observed MW: 29kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3817

Uniprot URL

https://www.uniprot.org/uniprot/P20151

AA Sequence

IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA (Man1a1), partial
MBS7112004 Inquire

Recombinant Mouse Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA (Man1a1), partial

Sign In for Pricing
View Details
At1g50880 Antibody
orb788536 2 mg

At1g50880 Antibody

Sign In for Pricing
View Details
Brucella Broth (Powder)
B2900-02 500 g

Brucella Broth (Powder)

Sign In for Pricing
View Details
Prometon-13C3
TRC-P757037-25MG 25 mg

Prometon-13C3

Sign In for Pricing
View Details
Olfr617 3'UTR Luciferase Stable Cell Line
TU115364 1.0 mL

Olfr617 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PGB Strip
ABT-DOA-A272 50 Tests

PGB Strip

Sign In for Pricing
View Details